Accessibility digest

Synopsis
PageCandidate Joe Patterson (R)
URLhttps://joepatterson.com/
Requesterpool@jpdev.pro
Test date2023/06/18
Score1696
Tested byTestaro, procedure ts27
Scored byTestilo, procedure tsp27
Digested byTestilo, procedure tdp27

Introduction

This is a digest of results from a battery of web accessibility tests.

Ten different tools (Alfa, Axe, Continuum, Equal Access, HTML CodeSniffer, Nu Html Checker, QualWeb, Tenon, Testaro, and WAVE) tested the web page of Candidate Joe Patterson (R) at https://joepatterson.com/ to check its compliance with various rules. There were a total of about 1350 rules, classified into about 250 accessibility issues.

The results were interpreted to yield an aggregate score of 1696, where 0 would be perfect.

Total score

The total score is the sum of five components.

Score summary
ComponentScoreDescription
total1696Sum of the component scores
issue1456Severity and number of reported defects
tool219Tool-by-tool defect ratings
prevention0Failed attempts by tools to test the page
log21Browser warnings about the page
latency0Abnormal delay in page responses

Issue scores

The score of an issue depends on the severity (user impact and certainty) of the issue and on how many instances were reported (by one or more tools).

Issue scores
IssueScore
focusIndication136
fontSizeAbsolute100
fatalError100
colorMissing92
duplicateID88
linkIndication88
textContrastAA76
targetSize54
slashParseRisk46
contentBeyondLandmarks40
controlNoText40
inputNoText40
errorReferenceBad40
linkForcesNewWindow39
overflowHiddenRisk34
inputOnlyPlaceholder30
linkElementBad24
svgImageNoText20
labelClash20
siteNavigation19
elementClosure18
pseudoHeadingRisk17
linkNoText16
hiddenContentRisk13
linkWindowSurpriseRisk13
allCaps13
imageNoText12
contrastAAA12
obsolete12
metaBad12
cssInvalid12
pseudoNavList12
zIndexNotZero12
linkTextsSame10
repeatedContentRisk9
submitButton9
leadingInsufficient8
parentBad8
leadingClipsText8
hoverSurprise8
navConfusion6
navNoText6
parseError6
skipRepeatedContent6
fontSmall6
focusableOperable6
typeRedundant5
justification4
internalLinkBroken4
textRotated4
inconsistentStyles4
linkPair4
noHeading3
landmarkConfusion3
h1Missing3
decorativeImageRisk3
scrollRisk3
roleBad3
horizontalScrolling3
linkVague3
autocompleteNone3
mainNone2
justificationRisk2
noScriptRisk2
contrastRisk1
visibleBulk1

Itemized issues

The reported rule violations are itemized below, issue by issue. Additional details can be inspected in the complete report at the end of this page.

Issue focusIndication

WCAG: 2.4.7

Score: 136

Complaints by alfa

Rule r65

Description: Element in the sequential focus order has no visible focus

Count of instances: 34

Complaint specifics

Complaints by qualWeb

Rule QW-ACT-R62

Description: Element in the sequential focus order has no visible focus

Count of instances: 34

Complaint specifics

Complaints by testaro

Rule focInd

Description: Focused element displays a nonstandard or no focus indicator

Count of instances: 34

Complaint specifics

Issue fontSizeAbsolute

WCAG: 1.4.4

Score: 100

Complaints by alfa

Rule r74

Description: Paragraph text has an absolute font size

Count of instances: 5

Complaint specifics

Complaints by qualWeb

Rule QW-WCAG-T28

Description: Percent, em, or name is used for a font size

Count of instances: 50

Complaint specifics

Issue fatalError

WCAG: 4.1

Score: 100

Complaints by nuVal

Rule Cannot recover after last error. Any further errors will be ignored.

Description: Testing was interrupted by a fatal error

Count of instances: 2

Complaint specifics

Issue colorMissing

WCAG: 1.4.3

Score: 92

Complaints by qualWeb

Rule QW-WCAG-T31

Description: Foreground or background color is specified but not both

Count of instances: 23

Complaint specifics

Issue duplicateID

WCAG: 4.1.1

Score: 88

Complaints by alfa

Rule r3

Description: Element id attribute value is not unique

Count of instances: 6

Complaint specifics

Complaints by axe

Rule duplicate-id

Description: id attribute value is not unique

Count of instances: 2

Complaint specifics

Complaints by continuum

Rule 94

Description: Element contains an id attribute set to a value that is not unique in the DOM

Count of instances: 6

Complaint specifics

Complaints by htmlcs

Rule AAA.4_1_1.F77

Description: Duplicate id attribute value

Count of instances: 3

Complaint specifics

Complaints by ibm

Rule element_id_unique

Description: Element has an id attribute value that is already in use

Count of instances: 22

Complaint specifics

Complaints by qualWeb

Rule QW-ACT-R18

Description: id attribute value is not unique

Count of instances: 8

Complaint specifics

Issue linkIndication

WCAG: 1.3.3

Score: 88

Complaints by testaro

Rule linkUl

Description: Non-underlined adjacent links

Count of instances: 44

Complaint specifics

Issue textContrastAA

WCAG: 1.4.3

Score: 76

Complaints by alfa

Rule r69

Description: Text outside widget has subminimum contrast

Count of instances: 5

Complaint specifics

Complaints by axe

Rule color-contrast

Description: Element has insufficient color contrast

Count of instances: 11

Complaint specifics

Complaints by htmlcs

Rule AAA.1_4_6.G18.Fail

Description: Contrast between the text and its background is less than 4.5:1

Count of instances: 5

Complaint specifics

Complaints by qualWeb

Rule QW-ACT-R37

Description: Text has less than the minimum contrast

Count of instances: 10

Complaint specifics

Complaints by wave

Rule contrast

Description: Very low contrast

Count of instances: 19

Complaint specifics

Issue targetSize

WCAG: 2.5.5

Score: 54

Complaints by tenon

Rule 152

Description: Actionable element is smaller than the minimum required size

Count of instances: 18

Complaint specifics

Issue slashParseRisk

WCAG: 4.1

Score: 46

Complaints by nuVal

Rule Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.

Description: Void element has a useless trailing slash.

Count of instances: 46

Complaint specifics

Issue contentBeyondLandmarks

WCAG: 1.3.6

Score: 40

Complaints by alfa

Rule r57

Description: Perceivable text content is not included in any landmark

Count of instances: 20

Complaint specifics

Complaints by axe

Rule region

Description: Some page content is not contained by landmarks

Count of instances: 20

Complaint specifics

Complaints by ibm

Rule aria_content_in_landmark

Description: Content is not within a landmark element

Count of instances: 16

Complaint specifics

Issue controlNoText

WCAG: 4.1.2

Score: 40

Complaints by htmlcs

Rule AAA.1_3_1.F68

Description: Form control has no label

Count of instances: 7

Complaint specifics

Complaints by wave

Rule label_missing

Description: form element has no label

Count of instances: 10

Complaint specifics

Issue inputNoText

WCAG: 4.1.2

Score: 40

Complaints by htmlcs

Rule AAA.4_1_2.H91.InputEmail.Name

Description: Email input has no accessible name

Count of instances: 3

Complaint specifics
Rule AAA.4_1_2.H91.InputText.Name

Description: Text input has no accessible name

Count of instances: 7

Complaint specifics

Issue errorReferenceBad

WCAG: 3.3.1

Score: 40

Complaints by qualWeb

Rule QW-ACT-R41

Description: Error message describes no invalid form field value

Count of instances: 10

Complaint specifics

Issue linkForcesNewWindow

WCAG: 3.2.5

Score: 39

Complaints by tenon

Rule 218

Description: Link opens in a new window without user control

Count of instances: 13

Complaint specifics

Issue overflowHiddenRisk

WCAG: 1.4.4

Score: 34

Complaints by qualWeb

Rule QW-ACT-R40

Description: Zoomed text node may be clipped by a CSS overflow declaration

Count of instances: 34

Complaint specifics

Issue inputOnlyPlaceholder

WCAG: 4.1.2

Score: 30

Complaints by continuum

Rule 863

Description: input has an accessible name that depends on a placeholder

Count of instances: 10

Complaint specifics

Issue linkElementBad

WCAG: 1.3.1

Score: 24

Complaints by htmlcs

Rule AAA.2_4_8.H59.1

Description: link element is not in the document head

Count of instances: 6

Complaint specifics

Complaints by nuVal

Rule A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.

Description: link element with a body ancestor has no itemprop or valid rel attribute

Count of instances: 3

Complaint specifics

Issue svgImageNoText

WCAG: 1.1.1

Score: 20

Complaints by continuum

Rule 123

Description: svg element has no machanism allowing an accessible name to be calculated

Count of instances: 5

Complaint specifics

Issue labelClash

WCAG: 1.3.1

Score: 20

Complaints by testaro

Rule labClash

Description: Incompatible label types

Count of instances: 10

Complaint specifics

Issue siteNavigation

WCAG: 2.4

Score: 19

Complaints by qualWeb

Rule QW-WCAG-T15

Description: link element and navigation tools not used

Count of instances: 19

Complaint specifics

Issue elementClosure

WCAG: 4.1.1

Score: 18

Complaints by nuVal

Rule ^Stray end tag .+$

Description: Invalid closing tag

Count of instances: 4

Complaint specifics
Rule ^Start tag .+ seen but an element of the same type was already open.*$

Description: Element is invalidly a descendant of another such element

Count of instances: 2

Complaint specifics

Issue pseudoHeadingRisk

WCAG: 1.3.1

Score: 17

Complaints by htmlcs

Rule AAA.1_3_1.H42

Description: Heading coding is not used but the element may be intended as a heading

Count of instances: 2

Complaint specifics

Complaints by wave

Rule heading_possible

Description: Possible heading

Count of instances: 17

Complaint specifics

Issue linkNoText

WCAG: 2.4.4

Score: 16

Complaints by alfa

Rule r11

Description: Link has no accessible name

Count of instances: 3

Complaint specifics

Complaints by axe

Rule link-name

Description: Link has no discernible text

Count of instances: 3

Complaint specifics

Complaints by continuum

Rule 237

Description: a element has no machanism allowing an accessible name value to be calculated

Count of instances: 3

Complaint specifics

Complaints by htmlcs

Rule AAA.4_1_2.H91.A.NoContent

Description: Link has an href attribute but no text

Count of instances: 3

Complaint specifics

Complaints by ibm

Rule a_text_purpose

Description: Hyperlink has no link text, label, or image with a text alternative

Count of instances: 4

Complaint specifics

Complaints by qualWeb

Rule QW-ACT-R12

Description: Link has no accessible name

Count of instances: 3

Complaint specifics
Rule QW-WCAG-T21

Description: Accessible name is not provided for an image which is the only content in a link

Count of instances: 1

Complaint specifics

Complaints by tenon

Rule 57

Description: Link has no text inside it

Count of instances: 4

Complaint specifics

Complaints by wave

Rule alt_link_missing

Description: Linked image has no text alternative

Count of instances: 1

Complaint specifics
Rule link_empty

Description: Link contains no text

Count of instances: 3

Complaint specifics

Issue hiddenContentRisk

WCAG: 4.1

Score: 13

Complaints by axe

Rule hidden-content

Description: Some content is hidden and therefore may not be testable for accessibility

Count of instances: 13

Complaint specifics

Issue linkWindowSurpriseRisk

WCAG: 3.2.5

Score: 13

Complaints by htmlcs

Rule AAA.3_2_5.H83.3

Description: Link text may fail to indicate that the link will open in a new window

Count of instances: 13

Complaint specifics

Issue allCaps

WCAG: 3.1.5

Score: 13

Complaints by tenon

Rule 153

Description: Long string of text is in all caps

Count of instances: 13

Complaint specifics

Issue imageNoText

WCAG: 1.1.1

Score: 12

Complaints by alfa

Rule r2

Description: Image has no accessible name

Count of instances: 1

Complaint specifics

Complaints by axe

Rule image-alt

Description: Image has no text alternative

Count of instances: 1

Complaint specifics

Complaints by continuum

Rule 89

Description: img element has no machanism allowing an accessible name to be calculated

Count of instances: 1

Complaint specifics

Complaints by htmlcs

Rule AAA.1_1_1.H37

Description: img element has no alt attribute

Count of instances: 1

Complaint specifics

Complaints by ibm

Rule img_alt_valid

Description: Image has neither an alt attribute nor an ARIA label or title

Count of instances: 1

Complaint specifics

Complaints by nuVal

Rule An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.

Description: img element has no alt attribute

Count of instances: 3

Complaint specifics

Complaints by qualWeb

Rule QW-ACT-R17

Description: Image has no accessible name

Count of instances: 1

Complaint specifics

Complaints by wave

Rule alt_spacer_missing

Description: Spacer image has no text alternative

Count of instances: 1

Complaint specifics

Issue contrastAAA

WCAG: 1.4.6

Score: 12

Complaints by alfa

Rule r66

Description: Text contrast less than AAA requires

Count of instances: 6

Complaint specifics

Complaints by axe

Rule color-contrast-enhanced

Description: Element has insufficient color contrast (Level AAA)

Count of instances: 1

Complaint specifics

Complaints by htmlcs

Rule AAA.1_4_6.G17.Fail

Description: Text has insufficient contrast

Count of instances: 3

Complaint specifics

Complaints by qualWeb

Rule QW-ACT-R76

Description: Text has less than the enhanced minimum contrast

Count of instances: 12

Complaint specifics

Issue obsolete

WCAG: 4.1

Score: 12

Complaints by ibm

Rule element_attribute_deprecated

Description: Element or attribute is obsolete

Count of instances: 4

Complaint specifics

Issue metaBad

WCAG: 1.3.1

Score: 12

Complaints by nuVal

Rule ^Attribute .+ not allowed on element meta at this point.*$

Description: Attribute is not allowed on a meta element here

Count of instances: 2

Complaint specifics
Rule ^Element meta is missing one or more of the following attributes: .+$

Description: meta element is missing a required attribute

Count of instances: 2

Complaint specifics

Issue cssInvalid

WCAG: 4.1

Score: 12

Complaints by nuVal

Rule ^CSS: .+: Character .+ is neither a decimal digit number.*$

Description: Nonnumeric character in a numeric style property

Count of instances: 4

Complaint specifics

Issue pseudoNavList

WCAG: 1.3.1

Score: 12

Complaints by qualWeb

Rule QW-WCAG-T32

Description: ol, ul or dl is not used for a list or group of links

Count of instances: 6

Complaint specifics

Issue zIndexNotZero

WCAG: 1.4

Score: 12

Complaints by testaro

Rule zIndex

Description: Layering with nondefault z-index values

Count of instances: 12

Complaint specifics

Issue linkTextsSame

WCAG: 2.4.4

Score: 10

Complaints by tenon

Rule 98

Description: Links have the same text but different destinations

Count of instances: 5

Complaint specifics

Issue repeatedContentRisk

WCAG: 2.4.1

Score: 9

Complaints by alfa

Rule r87

Description: First focusable element is not a link to the main content

Count of instances: 1

Complaint specifics

Complaints by qualWeb

Rule QW-ACT-R73

Description: Block of repeated content is not collapsible

Count of instances: 1

Complaint specifics
Rule QW-ACT-R74

Description: Document has no instrument to move focus to non-repeated content

Count of instances: 1

Complaint specifics
Rule QW-WCAG-T23

Description: No link at the top of the page that goes directly to the main content area

Count of instances: 1

Complaint specifics
Rule QW-BP17

Description: No link at the beginning of a block of repeated content goes to the end of the block

Count of instances: 6

Complaint specifics

Issue submitButton

WCAG: 2.5.6

Score: 9

Complaints by qualWeb

Rule QW-WCAG-T19

Description: Submit button not provided

Count of instances: 3

Complaint specifics

Issue leadingInsufficient

WCAG: 1.4.8

Score: 8

Complaints by alfa

Rule r73

Description: Paragraph of text has insufficient line height

Count of instances: 4

Complaint specifics

Issue parentBad

WCAG: 1.3.1

Score: 8

Complaints by nuVal

Rule ^Element .+ not allowed as child of element .+ in this context.*$

Description: Element has an invalid parent

Count of instances: 2

Complaint specifics

Issue leadingClipsText

WCAG: 1.4.8

Score: 8

Complaints by tenon

Rule 144

Description: Line height is insufficent to properly display the computed font size

Count of instances: 2

Complaint specifics

Issue hoverSurprise

WCAG: 1.4.13

Score: 8

Complaints by testaro

Rule hover

Description: Hovering is impossible or mis-indicated or changes content

Count of instances: 4

Complaint specifics

Issue navConfusion

WCAG: 1.3.6

Score: 6

Complaints by continuum

Rule 531

Description: nav element has an accessible name that is non-unique among the nav elements

Count of instances: 2

Complaint specifics

Issue navNoText

WCAG: 1.3.6

Score: 6

Complaints by continuum

Rule 533

Description: nav element is not the only nav element but has no accessible name

Count of instances: 2

Complaint specifics

Issue parseError

WCAG: 4.1

Score: 6

Complaints by nuVal

Rule ^Bad start tag in .+$

Description: Invalid start tag

Count of instances: 2

Complaint specifics

Issue skipRepeatedContent

WCAG: 2.4.1

Score: 6

Complaints by qualWeb

Rule QW-ACT-R64

Description: Document has no heading for non-repeated content

Count of instances: 1

Complaint specifics
Rule QW-ACT-R75

Description: Blocks of repeated content cannot be bypassed

Count of instances: 1

Complaint specifics

Issue fontSmall

WCAG: 1.4

Score: 6

Complaints by tenon

Rule 134

Description: Text is very small

Count of instances: 2

Complaint specifics

Issue focusableOperable

WCAG: 2.1.1

Score: 6

Complaints by testaro

Rule focOp

Description: Tab-focusable elements that are inoperable or operable elements that are not focusable

Count of instances: 2

Complaint specifics

Issue typeRedundant

WCAG: 1.3.1

Score: 5

Complaints by nuVal

Rule The type attribute is unnecessary for JavaScript resources.

Description: type attribute is unnecessary for a JavaScript resource

Count of instances: 5

Complaint specifics

Issue justification

WCAG: 1.4.8

Score: 4

Complaints by alfa

Rule r71

Description: Paragraph text is fully justified

Count of instances: 1

Complaint specifics

Complaints by tenon

Rule 36

Description: Text is fully justified

Count of instances: 2

Complaint specifics

Complaints by wave

Rule text_justified

Description: Text is justified

Count of instances: 2

Complaint specifics

Issue internalLinkBroken

WCAG: 1.3.1

Score: 4

Complaints by htmlcs

Rule AAA.2_4_1.G1,G123,G124.NoSuchID

Description: Internal link references a nonexistent destination

Count of instances: 1

Complaint specifics

Complaints by wave

Rule link_internal_broken

Description: Broken same-page link

Count of instances: 1

Complaint specifics

Issue textRotated

WCAG: 1.4.8

Score: 4

Complaints by tenon

Rule 271

Description: Text is needlessly rotated 60+ degrees or more, hurting comprehension

Count of instances: 2

Complaint specifics

Issue inconsistentStyles

WCAG: 3.2.4

Score: 4

Complaints by testaro

Rule styleDiff

Description: Heading, link, and button style inconsistencies

Count of instances: 4

Complaint specifics

Issue linkPair

WCAG: 2.4.4

Score: 4

Complaints by wave

Rule link_redundant

Description: Adjacent links go to the same URL

Count of instances: 2

Complaint specifics

Issue noHeading

WCAG: 1.3.1

Score: 3

Complaints by alfa

Rule r59

Description: Document has no headings

Count of instances: 1

Complaint specifics

Complaints by wave

Rule heading_missing

Description: Page has no headings

Count of instances: 1

Complaint specifics

Issue landmarkConfusion

WCAG: 1.3.6

Score: 3

Complaints by axe

Rule landmark-unique

Description: Landmark has a role and an accessible name that are identical to another

Count of instances: 1

Complaint specifics

Issue h1Missing

WCAG: 1.3.1

Score: 3

Complaints by axe

Rule page-has-heading-one

Description: Page contains no level-one heading

Count of instances: 1

Complaint specifics

Issue decorativeImageRisk

WCAG: 1.1.1

Score: 3

Complaints by htmlcs

Rule AAA.1_1_1.H67.2

Description: Image marked as decorative may be informative

Count of instances: 3

Complaint specifics

Issue scrollRisk

WCAG: 1.4.10

Score: 3

Complaints by htmlcs

Rule AAA.1_4_10.C32,C31,C33,C38,SCR34,G206

Description: Fixed-position element may force bidirectional scrolling

Count of instances: 3

Complaint specifics

Issue roleBad

WCAG: 4.1.2

Score: 3

Complaints by ibm

Rule aria_contentinfo_misuse

Description: Element with a contentinfo role is present without an element with a main role

Count of instances: 1

Complaint specifics

Issue horizontalScrolling

WCAG: 1.4.10

Score: 3

Complaints by tenon

Rule 28

Description: Layout or sizing of the page causes horizontal scrolling

Count of instances: 1

Complaint specifics

Issue linkVague

WCAG: 2.4.4

Score: 3

Complaints by tenon

Rule 73

Description: Link text is too generic to communicate the purpose or destination

Count of instances: 1

Complaint specifics

Issue autocompleteNone

WCAG: 1.3.5

Score: 3

Complaints by testaro

Rule autocomplete

Description: Name or email input is missing its required autocomplete attribute

Count of instances: 3

Complaint specifics

Issue mainNone

WCAG: 1.3.6

Score: 2

Complaints by axe

Rule landmark-one-main

Description: page has no main landmark

Count of instances: 1

Complaint specifics

Complaints by qualWeb

Rule QW-ACT-R63

Description: Document has no landmark with non-repeated content

Count of instances: 1

Complaint specifics

Issue justificationRisk

WCAG: 1.4.8

Score: 2

Complaints by qualWeb

Rule QW-WCAG-T29

Description: Alignment either to the left or right is not specified in CSS

Count of instances: 2

Complaint specifics

Issue noScriptRisk

WCAG: 4.1

Score: 2

Complaints by wave

Rule noscript

Description: noscript element may fail to contain an accessible equivalent or alternative

Count of instances: 2

Complaint specifics

Issue contrastRisk

WCAG: 1.4.3

Score: 1

Complaints by htmlcs

Rule AAA.1_4_3_F24.F24.FGColour

Description: Inline foreground color may lack a complementary background color

Count of instances: 1

Complaint specifics

Issue visibleBulk

WCAG: 2.4

Score: 1

Complaints by testaro

Rule bulk

Description: Page contains many visible elements

Count of instances: 1

Complaint specifics

Complete report

{
  "id": "18ixx-ts27-caAD5-c",
  "what": "accessibility tests",
  "strict": true,
  "timeLimit": 330,
  "acts": [
    {
      "type": "launch",
      "which": "webkit",
      "startTime": 1687099488340,
      "endTime": 1687099488914
    },
    {
      "type": "url",
      "which": "https://joepatterson.com/",
      "what": "Candidate Joe Patterson (R)",
      "startTime": 1687099488914,
      "result": {
        "url": "https://joepatterson.com/"
      },
      "endTime": 1687099490678
    },
    {
      "type": "tenonRequest",
      "id": "a",
      "withNewContent": false,
      "what": "Tenon API version 2 test request, with page content",
      "startTime": 1687099490679,
      "url": "https://joepatterson.com/",
      "endTime": 1687099491959
    },
    {
      "type": "test",
      "which": "testaro",
      "what": "Testaro",
      "withItems": true,
      "rules": [
        "y",
        "motion"
      ],
      "startTime": 1687099491959,
      "url": "https://joepatterson.com/",
      "result": {
        "rules": {
          "motion": {
            "what": "motion without user request",
            "data": {
              "bytes": [
                302393,
                302393,
                302393,
                302393,
                302393
              ],
              "localRatios": [
                1,
                1,
                1,
                1
              ],
              "meanLocalRatio": 1,
              "maxLocalRatio": 1,
              "globalRatio": 1,
              "pixelChanges": [
                0,
                0,
                0,
                0
              ],
              "meanPixelChange": 0,
              "maxPixelChange": 0,
              "changeFrequency": 0
            },
            "totals": [
              0,
              0,
              0,
              0
            ],
            "standardInstances": []
          }
        },
        "success": true
      },
      "standardResult": {
        "totals": [
          0,
          0,
          0,
          0
        ],
        "instances": []
      },
      "endTime": 1687099505453
    },
    {
      "type": "launch",
      "which": "chromium",
      "startTime": 1687099505453,
      "endTime": 1687099506089
    },
    {
      "type": "url",
      "which": "https://joepatterson.com/",
      "what": "Candidate Joe Patterson (R)",
      "startTime": 1687099506089,
      "result": {
        "url": "https://joepatterson.com/"
      },
      "endTime": 1687099507351
    },
    {
      "type": "test",
      "which": "alfa",
      "startTime": 1687099507351,
      "url": "https://joepatterson.com/",
      "what": "alfa",
      "result": {
        "totals": {
          "failures": 42,
          "warnings": 45
        },
        "items": [
          {
            "index": 2,
            "verdict": "failed",
            "rule": {
              "ruleID": "r11",
              "ruleSummary": "Links have an accessible name",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r11",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#link-purpose-in-context",
                  "chapter": "2.4.4",
                  "title": "Link Purpose (In Context)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#link-purpose-link-only",
                  "chapter": "2.4.9",
                  "title": "Link Purpose (Link Only)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#name-role-value",
                  "chapter": "4.1.2",
                  "title": "Name, Role, Value"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G91",
                  "name": "G91",
                  "title": "Providing link text that describes the purpose of a link"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\">",
                "  <picture class=\"brz-picture brz-d-block brz-p-relative brz-css-ptqop\">",
                "    <img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">",
                "  </picture>",
                "</a>"
              ]
            }
          },
          {
            "index": 21,
            "verdict": "failed",
            "rule": {
              "ruleID": "r11",
              "ruleSummary": "Links have an accessible name",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r11",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#link-purpose-in-context",
                  "chapter": "2.4.4",
                  "title": "Link Purpose (In Context)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#link-purpose-link-only",
                  "chapter": "2.4.9",
                  "title": "Link Purpose (Link Only)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#name-role-value",
                  "chapter": "4.1.2",
                  "title": "Name, Role, Value"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G91",
                  "name": "G91",
                  "title": "Providing link text that describes the purpose of a link"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span brz-icon css-1yqt0eo\">",
                "    <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg\" data-type=\"glyph\" data-name=\"logo-facebook\">",
                "      <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
                "        <path fill=\"currentColor\" d=\"M22,0H2C0.895,0,0,0.895,0,2v20c0,1.105,0.895,2,2,2h11v-9h-3v-4h3V8.413c0-3.1,1.893-4.788,4.659-4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\"></path...",
                "      </g>",
                "    </svg>",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 22,
            "verdict": "failed",
            "rule": {
              "ruleID": "r11",
              "ruleSummary": "Links have an accessible name",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r11",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#link-purpose-in-context",
                  "chapter": "2.4.4",
                  "title": "Link Purpose (In Context)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#link-purpose-link-only",
                  "chapter": "2.4.9",
                  "title": "Link Purpose (Link Only)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#name-role-value",
                  "chapter": "4.1.2",
                  "title": "Name, Role, Value"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G91",
                  "name": "G91",
                  "title": "Providing link text that describes the purpose of a link"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span brz-icon css-1ldonqd\">",
                "    <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg\" data-type=\"glyph\" data-name=\"logo-twitter\">",
                "      <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
                "        <path fill=\"currentColor\" d=\"M24,4.6c-0.9,0.4-1.8,0.7-2.8,0.8c1-0.6,1.8-1.6,2.2-2.7c-1,0.6-2,1-3.1,1.2c-0.9-1-2.2-1.6-3.6-1.6 c-2.7,0-4.9,2.2-4.9,4.9c0,0.4,0,0.8,0.1,1.1C7.7,8.1,4.1,6.1,1.7,3.1C1.2,3.9,1,4.7,1,5.6c0,1.7,0.9,3.2,2.2,4.1 C2.4,9.7,1.6,9.5,1,9.1c0,0,0,0,0,0.1c0,2.4,1.7,4.4,3.9,4...",
                "      </g>",
                "    </svg>",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 36,
            "verdict": "failed",
            "rule": {
              "ruleID": "r2",
              "ruleSummary": "Images have an accessible name",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r2",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#non-text-content",
                  "chapter": "1.1.1",
                  "title": "Non-text Content"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G94",
                  "name": "G94",
                  "title": "Providing short text alternative for non-text content that serves the same purpose"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G95",
                  "name": "G95",
                  "title": "Providing short text alternatives that provide a brief description of the non-text"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "img",
              "path": "/html[1]/body[1]/img[1]",
              "codeLines": [
                "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">"
              ]
            }
          },
          {
            "index": 75,
            "verdict": "failed",
            "rule": {
              "ruleID": "r3",
              "ruleSummary": "id attributes have a unique value",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r3",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#parsing",
                  "chapter": "4.1.1",
                  "title": "Parsing"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
                  "name": "H93",
                  "title": "Ensuring that id attributes are unique on a Web page"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "g",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]",
              "codeLines": [
                "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">",
                "  <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
                "  <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
                "</g>"
              ]
            }
          },
          {
            "index": 76,
            "verdict": "failed",
            "rule": {
              "ruleID": "r3",
              "ruleSummary": "id attributes have a unique value",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r3",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#parsing",
                  "chapter": "4.1.1",
                  "title": "Parsing"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
                  "name": "H93",
                  "title": "Ensuring that id attributes are unique on a Web page"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "path",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[1]",
              "codeLines": [
                "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
              ]
            }
          },
          {
            "index": 77,
            "verdict": "failed",
            "rule": {
              "ruleID": "r3",
              "ruleSummary": "id attributes have a unique value",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r3",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#parsing",
                  "chapter": "4.1.1",
                  "title": "Parsing"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
                  "name": "H93",
                  "title": "Ensuring that id attributes are unique on a Web page"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "path",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[2]",
              "codeLines": [
                "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
              ]
            }
          },
          {
            "index": 112,
            "verdict": "failed",
            "rule": {
              "ruleID": "r3",
              "ruleSummary": "id attributes have a unique value",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r3",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#parsing",
                  "chapter": "4.1.1",
                  "title": "Parsing"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
                  "name": "H93",
                  "title": "Ensuring that id attributes are unique on a Web page"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "g",
              "path": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]",
              "codeLines": [
                "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">",
                "  <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
                "  <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
                "</g>"
              ]
            }
          },
          {
            "index": 113,
            "verdict": "failed",
            "rule": {
              "ruleID": "r3",
              "ruleSummary": "id attributes have a unique value",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r3",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#parsing",
                  "chapter": "4.1.1",
                  "title": "Parsing"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
                  "name": "H93",
                  "title": "Ensuring that id attributes are unique on a Web page"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "path",
              "path": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[1]",
              "codeLines": [
                "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
              ]
            }
          },
          {
            "index": 114,
            "verdict": "failed",
            "rule": {
              "ruleID": "r3",
              "ruleSummary": "id attributes have a unique value",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r3",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#parsing",
                  "chapter": "4.1.1",
                  "title": "Parsing"
                },
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
                  "name": "H93",
                  "title": "Ensuring that id attributes are unique on a Web page"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "path",
              "path": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[2]",
              "codeLines": [
                "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
              ]
            }
          },
          {
            "index": 167,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]/span[1]/text()[1]",
              "codeLines": [
                "DONATE"
              ]
            }
          },
          {
            "index": 168,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
              "codeLines": [
                "THANK YOU!"
              ]
            }
          },
          {
            "index": 169,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]",
              "codeLines": [
                "Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
              ]
            }
          },
          {
            "index": 170,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]",
              "codeLines": [
                "-Joe Patterson"
              ]
            }
          },
          {
            "index": 171,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[2]/div[1]/div[1]/p[1]/strong[1]/text()[1]",
              "codeLines": [
                "JOE PATTERSON"
              ]
            }
          },
          {
            "index": 172,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[3]/div[1]/div[1]/p[1]/span[1]/text()[1]",
              "codeLines": [
                "Your voice in the State Assembly."
              ]
            }
          },
          {
            "index": 173,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
              "codeLines": [
                "STAND WITH JOE:"
              ]
            }
          },
          {
            "index": 174,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]/span[1]/text()[1]",
              "codeLines": [
                "$5"
              ]
            }
          },
          {
            "index": 175,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]/span[1]/text()[1]",
              "codeLines": [
                "$10"
              ]
            }
          },
          {
            "index": 176,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]/span[1]/text()[1]",
              "codeLines": [
                "$25"
              ]
            }
          },
          {
            "index": 177,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]/span[1]/text()[1]",
              "codeLines": [
                "$50"
              ]
            }
          },
          {
            "index": 178,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]/span[1]/text()[1]",
              "codeLines": [
                "$75"
              ]
            }
          },
          {
            "index": 179,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]/span[1]/text()[1]",
              "codeLines": [
                "OTHER"
              ]
            }
          },
          {
            "index": 180,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
              "codeLines": [
                "JOIN THE TEAM"
              ]
            }
          },
          {
            "index": 181,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]/span[1]/text()[1]",
              "codeLines": [
                "SUBMIT"
              ]
            }
          },
          {
            "index": 182,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
              "codeLines": [
                "Meet Joe Patterson"
              ]
            }
          },
          {
            "index": 183,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]",
              "codeLines": [
                "Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
              ]
            }
          },
          {
            "index": 184,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]/span[1]/text()[1]",
              "codeLines": [
                "Learn More"
              ]
            }
          },
          {
            "index": 185,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/strong[1]/text()[1]",
              "codeLines": [
                "Endorse Joe"
              ]
            }
          },
          {
            "index": 186,
            "verdict": "failed",
            "rule": {
              "ruleID": "r57",
              "ruleSummary": "Perceivable text content is included in a landmark",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r57",
              "requirements": []
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[5]/button[1]/span[1]/text()[1]",
              "codeLines": [
                "Endorse Joe!"
              ]
            }
          },
          {
            "index": 196,
            "verdict": "failed",
            "rule": {
              "ruleID": "r59",
              "ruleSummary": "Documents have headings",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r59",
              "requirements": []
            },
            "target": {
              "type": "document",
              "tagName": "",
              "path": "/",
              "codeLines": [
                "#document",
                "  <!doctype html>",
                "...",
                "  </html>"
              ]
            }
          },
          {
            "index": 203,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\">",
                "  <picture class=\"brz-picture brz-d-block brz-p-relative brz-css-ptqop\">",
                "    <img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">",
                "  </picture>",
                "</a>"
              ]
            }
          },
          {
            "index": 204,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span\">",
                "    Home",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 205,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]",
              "codeLines": [
                "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span\">",
                "    Meet Joe",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 206,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]",
              "codeLines": [
                "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span\">",
                "    News",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 207,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]",
              "codeLines": [
                "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span\">",
                "    AD5",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 208,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]",
              "codeLines": [
                "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span\">",
                "    Issues",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 209,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">",
                "  <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-css-oheuj\" data-type=\"glyph\" data-name=\"tail-right\">",
                "    <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
                "      <path fill=\"currentColor\" d=\"M22.707,11.293L15,3.586L13.586,5l6,6H2c-0.553,0-1,0.448-1,1s0.447,1,1,1h17.586l-6,6L15,20.414 l7.707-7.707C23.098,12.316,23.098,11.684,22.707,11.293z\"></path>",
                "    </g>",
                "  </svg>",
                "  <span class=\"brz-span brz-text__editor\">",
                "    DONATE",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 210,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">",
                "  <span class=\"brz-span brz-text__editor\">",
                "    $5",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 211,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]",
              "codeLines": [
                "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">",
                "  <span class=\"brz-span brz-text__editor\">",
                "    $10",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 212,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]",
              "codeLines": [
                "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">",
                "  <span class=\"brz-span brz-text__editor\">",
                "    $25",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 213,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]",
              "codeLines": [
                "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">",
                "  <span class=\"brz-span brz-text__editor\">",
                "    $50",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 214,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]",
              "codeLines": [
                "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">",
                "  <span class=\"brz-span brz-text__editor\">",
                "    $75",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 215,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]",
              "codeLines": [
                "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">",
                "  <span class=\"brz-span brz-text__editor\">",
                "    OTHER",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 216,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "input",
              "path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[1]/input[1]",
              "codeLines": [
                "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              ]
            }
          },
          {
            "index": 217,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "input",
              "path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[2]/input[1]",
              "codeLines": [
                "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              ]
            }
          },
          {
            "index": 218,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "input",
              "path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[3]/input[1]",
              "codeLines": [
                "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+..."
              ]
            }
          },
          {
            "index": 219,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "input",
              "path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[4]/input[1]",
              "codeLines": [
                "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              ]
            }
          },
          {
            "index": 220,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "input",
              "path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[5]/input[1]",
              "codeLines": [
                "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              ]
            }
          },
          {
            "index": 221,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "button",
              "path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]",
              "codeLines": [
                "<button class=\"brz-btn brz-btn-submit brz-css-ystbj\" data-custom-id=\"nxouluvbretczsumlwfttgzfltqnntvlwvaf\">",
                "  <span class=\"brz-span brz-text__editor\">",
                "    SUBMIT",
                "  </span>",
                "  <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
                "    <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
                "      <g class=\"nc-loop_circle-02-24\" transform=\"rotate(241.37571428571425 12 12)\">",
                "        <path opacity=\"0.4\" fill=\"currentColor\" d=\"M12,24C5.3833008,24,0,18.6166992,0,12S5.3833008,0,12,0s12,5.3833008,12,12 S18.6166992,24,12,24z M12,2C6.4858398,2,2,6.4858398,2,12s4.4858398,10,10,10s10-4.4858398,10-10S17.5141602,2,12,2z\"></path>",
                "        <path data-color=\"color-2\" fill=\"currentColor\" d=\"M24,12h-2c0-5.5141602-4.4858398-10-10-10V0C18.6166992,0,24,5.3833008,24,12z\"></path>",
                "      </g>",
                "      <script>",
                "        !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,...",
                "      </script>",
                "    </g>",
                "  </svg>",
                "</button>"
              ]
            }
          },
          {
            "index": 222,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\">",
                "  <span class=\"brz-span brz-text__editor\">",
                "    Learn More",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 223,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "input",
              "path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[1]/input[1]",
              "codeLines": [
                "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              ]
            }
          },
          {
            "index": 224,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "input",
              "path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[2]/input[1]",
              "codeLines": [
                "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              ]
            }
          },
          {
            "index": 225,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "input",
              "path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[3]/input[1]",
              "codeLines": [
                "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\..."
              ]
            }
          },
          {
            "index": 226,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "input",
              "path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[4]/input[1]",
              "codeLines": [
                "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              ]
            }
          },
          {
            "index": 227,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "button",
              "path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[5]/button[1]",
              "codeLines": [
                "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-dyvgx\" data-custom-id=\"pctxnochcdlwubleyhhicvdleifnqiyrttuh\">",
                "  <span class=\"brz-span brz-text__editor\">",
                "    Endorse Joe!",
                "  </span>",
                "  <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
                "    <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
                "      <g class=\"nc-loop_circle-02-24\" transform=\"rotate(241.37571428571425 12 12)\">",
                "        <path opacity=\"0.4\" fill=\"currentColor\" d=\"M12,24C5.3833008,24,0,18.6166992,0,12S5.3833008,0,12,0s12,5.3833008,12,12 S18.6166992,24,12,24z M12,2C6.4858398,2,2,6.4858398,2,12s4.4858398,10,10,10s10-4.4858398,10-10S17.5141602,2,12,2z\"></path>",
                "        <path data-color=\"color-2\" fill=\"currentColor\" d=\"M24,12h-2c0-5.5141602-4.4858398-10-10-10V0C18.6166992,0,24,5.3833008,24,12z\"></path>",
                "      </g>",
                "      <script>",
                "        !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,...",
                "      </script>",
                "    </g>",
                "  </svg>",
                "</button>"
              ]
            }
          },
          {
            "index": 228,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span\">",
                "    Home",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 229,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]",
              "codeLines": [
                "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span\">",
                "    Meet Joe",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 230,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]",
              "codeLines": [
                "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span\">",
                "    News",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 231,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]",
              "codeLines": [
                "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span\">",
                "    AD5",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 232,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]",
              "codeLines": [
                "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span\">",
                "    Issues",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 233,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "input",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[1]/input[1]",
              "codeLines": [
                "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\..."
              ]
            }
          },
          {
            "index": 234,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "button",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[2]/button[1]",
              "codeLines": [
                "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-rplcf\" data-custom-id=\"urngpgulgkggkfoivjalbjunpabjeeujtqmh\">",
                "  <span class=\"brz-span brz-text__editor\">",
                "    SUBMIT",
                "  </span>",
                "  <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
                "    <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
                "      <g class=\"nc-loop_circle-02-24\" transform=\"rotate(241.37571428571425 12 12)\">",
                "        <path opacity=\"0.4\" fill=\"currentColor\" d=\"M12,24C5.3833008,24,0,18.6166992,0,12S5.3833008,0,12,0s12,5.3833008,12,12 S18.6166992,24,12,24z M12,2C6.4858398,2,2,6.4858398,2,12s4.4858398,10,10,10s10-4.4858398,10-10S17.5141602,2,12,2z\"></path>",
                "        <path data-color=\"color-2\" fill=\"currentColor\" d=\"M24,12h-2c0-5.5141602-4.4858398-10-10-10V0C18.6166992,0,24,5.3833008,24,12z\"></path>",
                "      </g>",
                "      <script>",
                "        !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,...",
                "      </script>",
                "    </g>",
                "  </svg>",
                "</button>"
              ]
            }
          },
          {
            "index": 235,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span brz-icon css-1yqt0eo\">",
                "    <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg\" data-type=\"glyph\" data-name=\"logo-facebook\">",
                "      <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
                "        <path fill=\"currentColor\" d=\"M22,0H2C0.895,0,0,0.895,0,2v20c0,1.105,0.895,2,2,2h11v-9h-3v-4h3V8.413c0-3.1,1.893-4.788,4.659-4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\"></path...",
                "      </g>",
                "    </svg>",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 236,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r65",
              "ruleSummary": "Element in sequential focus order has visible focus",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r65",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
                  "chapter": "2.4.7",
                  "title": "Focus Visible"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "a",
              "path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
              "codeLines": [
                "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
                "  <span class=\"brz-span brz-icon css-1ldonqd\">",
                "    <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg\" data-type=\"glyph\" data-name=\"logo-twitter\">",
                "      <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
                "        <path fill=\"currentColor\" d=\"M24,4.6c-0.9,0.4-1.8,0.7-2.8,0.8c1-0.6,1.8-1.6,2.2-2.7c-1,0.6-2,1-3.1,1.2c-0.9-1-2.2-1.6-3.6-1.6 c-2.7,0-4.9,2.2-4.9,4.9c0,0.4,0,0.8,0.1,1.1C7.7,8.1,4.1,6.1,1.7,3.1C1.2,3.9,1,4.7,1,5.6c0,1.7,0.9,3.2,2.2,4.1 C2.4,9.7,1.6,9.5,1,9.1c0,0,0,0,0,0.1c0,2.4,1.7,4.4,3.9,4...",
                "      </g>",
                "    </svg>",
                "  </span>",
                "</a>"
              ]
            }
          },
          {
            "index": 238,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r66",
              "ruleSummary": "Text outside widget has enhanced contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r66",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
              "codeLines": [
                "THANK YOU!"
              ]
            }
          },
          {
            "index": 239,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r66",
              "ruleSummary": "Text outside widget has enhanced contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r66",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]",
              "codeLines": [
                "Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
              ]
            }
          },
          {
            "index": 240,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r66",
              "ruleSummary": "Text outside widget has enhanced contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r66",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]",
              "codeLines": [
                "-Joe Patterson"
              ]
            }
          },
          {
            "index": 247,
            "verdict": "failed",
            "rule": {
              "ruleID": "r66",
              "ruleSummary": "Text outside widget has enhanced contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r66",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]/span[1]/text()[1]",
              "codeLines": [
                "SUBMIT"
              ]
            }
          },
          {
            "index": 248,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r66",
              "ruleSummary": "Text outside widget has enhanced contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r66",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
              "codeLines": [
                "Meet Joe Patterson"
              ]
            }
          },
          {
            "index": 249,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r66",
              "ruleSummary": "Text outside widget has enhanced contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r66",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]",
              "codeLines": [
                "Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
              ]
            }
          },
          {
            "index": 266,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r69",
              "ruleSummary": "Text outside widget has minimum contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r69",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-minimum",
                  "chapter": "1.4.3",
                  "title": "Contrast (Minimum)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
              "codeLines": [
                "THANK YOU!"
              ]
            }
          },
          {
            "index": 267,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r69",
              "ruleSummary": "Text outside widget has minimum contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r69",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-minimum",
                  "chapter": "1.4.3",
                  "title": "Contrast (Minimum)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]",
              "codeLines": [
                "Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
              ]
            }
          },
          {
            "index": 268,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r69",
              "ruleSummary": "Text outside widget has minimum contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r69",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-minimum",
                  "chapter": "1.4.3",
                  "title": "Contrast (Minimum)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]",
              "codeLines": [
                "-Joe Patterson"
              ]
            }
          },
          {
            "index": 276,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r69",
              "ruleSummary": "Text outside widget has minimum contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r69",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-minimum",
                  "chapter": "1.4.3",
                  "title": "Contrast (Minimum)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
              "codeLines": [
                "Meet Joe Patterson"
              ]
            }
          },
          {
            "index": 277,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r69",
              "ruleSummary": "Text outside widget has minimum contrast",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r69",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-minimum",
                  "chapter": "1.4.3",
                  "title": "Contrast (Minimum)"
                },
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
                  "chapter": "1.4.6",
                  "title": "Contrast (Enhanced)"
                }
              ]
            },
            "target": {
              "type": "text",
              "tagName": "",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]",
              "codeLines": [
                "Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
              ]
            }
          },
          {
            "index": 283,
            "verdict": "failed",
            "rule": {
              "ruleID": "r71",
              "ruleSummary": "Paragraphs of text are not justified",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r71",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
                  "chapter": "1.4.8",
                  "title": "Visual Presentation"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "p",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]",
              "codeLines": [
                "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\">",
                "  <span class=\"brz-cp-color3\">",
                "    Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol.",
                "  </span>",
                "</p>"
              ]
            }
          },
          {
            "index": 292,
            "verdict": "failed",
            "rule": {
              "ruleID": "r73",
              "ruleSummary": "Paragraphs of text have sufficient line height",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r73",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
                  "chapter": "1.4.8",
                  "title": "Visual Presentation"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "p",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
              "codeLines": [
                "<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\">",
                "  <span class=\"brz-cp-color3\">",
                "    THANK YOU!",
                "  </span>",
                "</p>"
              ]
            }
          },
          {
            "index": 293,
            "verdict": "failed",
            "rule": {
              "ruleID": "r73",
              "ruleSummary": "Paragraphs of text have sufficient line height",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r73",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
                  "chapter": "1.4.8",
                  "title": "Visual Presentation"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "p",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]",
              "codeLines": [
                "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\">",
                "  <span class=\"brz-cp-color3\">",
                "    Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol.",
                "  </span>",
                "</p>"
              ]
            }
          },
          {
            "index": 294,
            "verdict": "failed",
            "rule": {
              "ruleID": "r73",
              "ruleSummary": "Paragraphs of text have sufficient line height",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r73",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
                  "chapter": "1.4.8",
                  "title": "Visual Presentation"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "p",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]",
              "codeLines": [
                "<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\">",
                "  <span class=\"brz-cp-color3\">",
                "    -Joe Patterson",
                "  </span>",
                "</p>"
              ]
            }
          },
          {
            "index": 295,
            "verdict": "failed",
            "rule": {
              "ruleID": "r73",
              "ruleSummary": "Paragraphs of text have sufficient line height",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r73",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
                  "chapter": "1.4.8",
                  "title": "Visual Presentation"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "p",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
              "codeLines": [
                "<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\">",
                "  <span class=\"brz-cp-color1\">",
                "    Meet Joe Patterson",
                "  </span>",
                "</p>"
              ]
            }
          },
          {
            "index": 297,
            "verdict": "failed",
            "rule": {
              "ruleID": "r74",
              "ruleSummary": "Paragraphs of text do not have font sizes defined in absolute units",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r74",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
                  "chapter": "1.4.8",
                  "title": "Visual Presentation"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "p",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
              "codeLines": [
                "<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\">",
                "  <span class=\"brz-cp-color3\">",
                "    THANK YOU!",
                "  </span>",
                "</p>"
              ]
            }
          },
          {
            "index": 298,
            "verdict": "failed",
            "rule": {
              "ruleID": "r74",
              "ruleSummary": "Paragraphs of text do not have font sizes defined in absolute units",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r74",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
                  "chapter": "1.4.8",
                  "title": "Visual Presentation"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "p",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]",
              "codeLines": [
                "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\">",
                "  <span class=\"brz-cp-color3\">",
                "    Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol.",
                "  </span>",
                "</p>"
              ]
            }
          },
          {
            "index": 299,
            "verdict": "failed",
            "rule": {
              "ruleID": "r74",
              "ruleSummary": "Paragraphs of text do not have font sizes defined in absolute units",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r74",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
                  "chapter": "1.4.8",
                  "title": "Visual Presentation"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "p",
              "path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]",
              "codeLines": [
                "<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\">",
                "  <span class=\"brz-cp-color3\">",
                "    -Joe Patterson",
                "  </span>",
                "</p>"
              ]
            }
          },
          {
            "index": 300,
            "verdict": "failed",
            "rule": {
              "ruleID": "r74",
              "ruleSummary": "Paragraphs of text do not have font sizes defined in absolute units",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r74",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
                  "chapter": "1.4.8",
                  "title": "Visual Presentation"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "p",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
              "codeLines": [
                "<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\">",
                "  <span class=\"brz-cp-color1\">",
                "    Meet Joe Patterson",
                "  </span>",
                "</p>"
              ]
            }
          },
          {
            "index": 301,
            "verdict": "failed",
            "rule": {
              "ruleID": "r74",
              "ruleSummary": "Paragraphs of text do not have font sizes defined in absolute units",
              "scope": "component",
              "uri": "https://alfa.siteimprove.com/rules/sia-r74",
              "requirements": [
                {
                  "uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
                  "chapter": "1.4.8",
                  "title": "Visual Presentation"
                }
              ]
            },
            "target": {
              "type": "element",
              "tagName": "p",
              "path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]",
              "codeLines": [
                "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">",
                "  Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, w...",
                "</p>"
              ]
            }
          },
          {
            "index": 386,
            "verdict": "cantTell",
            "rule": {
              "ruleID": "r87",
              "ruleSummary": "First focusable element is link to main content",
              "scope": "page",
              "uri": "https://alfa.siteimprove.com/rules/sia-r87",
              "requirements": [
                {
                  "uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G1",
                  "name": "G1",
                  "title": "Adding a link at the top of each page that goes directly to the main content area"
                }
              ]
            },
            "target": {
              "type": "document",
              "tagName": "",
              "path": "/",
              "codeLines": [
                "#document",
                "  <!doctype html>",
                "...",
                "  </html>"
              ]
            }
          }
        ],
        "success": true
      },
      "standardResult": {
        "totals": [
          45,
          0,
          0,
          42
        ],
        "instances": [
          {
            "ruleID": "r11",
            "what": "Links have an accessible name",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"> <picture class=\"brz-picture brz-d-block brz-p-relative brz- ... ss-ptqop\"> <img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\"> </picture> </a>"
          },
          {
            "ruleID": "r11",
            "what": "Links have an accessible name",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span brz-icon css-1yqt0eo\"> <svg version=\"1.1 ... 659-4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\"></path... </g> </svg> </span> </a>"
          },
          {
            "ruleID": "r11",
            "what": "Links have an accessible name",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span brz-icon css-1ldonqd\"> <svg version=\"1.1\" xmlns=\"http:/ ... 6-1.6 c-2.7,0-4.9,2.2-4.9,4.9c0,0.4,0,0.8,0.1,1.1C7.7,8.1,4.1,6.1,1.7,3.1C1.2,3.9,1,4.7,1,5.6c0,1.7,0.9,3.2,2.2,4.1 C2.4,9.7,1.6,9.5,1,9.1c0,0,0,0,0,0.1c0,2.4,1.7,4.4,3.9,4... </g> </svg> </span> </a>"
          },
          {
            "ruleID": "r2",
            "what": "Images have an accessible name",
            "ordinalSeverity": 3,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/img[1]"
            },
            "excerpt": "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">"
          },
          {
            "ruleID": "r3",
            "what": "id attributes have a unique value",
            "ordinalSeverity": 3,
            "tagName": "G",
            "id": "close-popup",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]"
            },
            "excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\"> <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonze ... th> <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path> </g>"
          },
          {
            "ruleID": "r3",
            "what": "id attributes have a unique value",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[1]"
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
          },
          {
            "ruleID": "r3",
            "what": "id attributes have a unique value",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[2]"
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
          },
          {
            "ruleID": "r3",
            "what": "id attributes have a unique value",
            "ordinalSeverity": 3,
            "tagName": "G",
            "id": "close-popup",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]"
            },
            "excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\"> <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonze ... th> <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path> </g>"
          },
          {
            "ruleID": "r3",
            "what": "id attributes have a unique value",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[1]"
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
          },
          {
            "ruleID": "r3",
            "what": "id attributes have a unique value",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[2]"
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]/span[1]/text()[1]"
            },
            "excerpt": "DONATE"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
            },
            "excerpt": "THANK YOU!"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]"
            },
            "excerpt": "Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]"
            },
            "excerpt": "-Joe Patterson"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "STRONG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[2]/div[1]/div[1]/p[1]/strong[1]/text()[1]"
            },
            "excerpt": "JOE PATTERSON"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[3]/div[1]/div[1]/p[1]/span[1]/text()[1]"
            },
            "excerpt": "Your voice in the State Assembly."
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
            },
            "excerpt": "STAND WITH JOE:"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]/span[1]/text()[1]"
            },
            "excerpt": "$5"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]/span[1]/text()[1]"
            },
            "excerpt": "$10"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]/span[1]/text()[1]"
            },
            "excerpt": "$25"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]/span[1]/text()[1]"
            },
            "excerpt": "$50"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]/span[1]/text()[1]"
            },
            "excerpt": "$75"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]/span[1]/text()[1]"
            },
            "excerpt": "OTHER"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
            },
            "excerpt": "JOIN THE TEAM"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]/span[1]/text()[1]"
            },
            "excerpt": "SUBMIT"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
            },
            "excerpt": "Meet Joe Patterson"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]"
            },
            "excerpt": "Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]/span[1]/text()[1]"
            },
            "excerpt": "Learn More"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "STRONG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/strong[1]/text()[1]"
            },
            "excerpt": "Endorse Joe"
          },
          {
            "ruleID": "r57",
            "what": "Perceivable text content is included in a landmark",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[5]/button[1]/span[1]/text()[1]"
            },
            "excerpt": "Endorse Joe!"
          },
          {
            "ruleID": "r59",
            "what": "Documents have headings",
            "ordinalSeverity": 3,
            "tagName": "",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/"
            },
            "excerpt": "#document <!doctype html> ... </html>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"> <picture class=\"brz-picture brz-d-block brz-p-relative brz- ... ss-ptqop\"> <img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\"> </picture> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Home </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Meet Joe </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> News </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> AD5 </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Issues </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-i ... 5l6,6H2c-0.553,0-1,0.448-1,1s0.447,1,1,1h17.586l-6,6L15,20.414 l7.707-7.707C23.098,12.316,23.098,11.684,22.707,11.293z\"></path> </g> </svg> <span class=\"brz-span brz-text__editor\"> DONATE </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\"> <span class=\"brz-span brz-text__editor\"> $5 </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\"> <span class=\"brz-span brz-text__editor\"> $10 </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\"> <span class=\"brz-span brz-text__editor\"> $25 </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\"> <span class=\"brz-span brz-text__editor\"> $50 </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\"> <span class=\"brz-span brz-text__editor\"> $75 </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\"> <span class=\"brz-span brz-text__editor\"> OTHER </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "INPUT",
            "id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[1]/input[1]"
            },
            "excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "INPUT",
            "id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[2]/input[1]"
            },
            "excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "INPUT",
            "id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[3]/input[1]"
            },
            "excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+..."
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "INPUT",
            "id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[4]/input[1]"
            },
            "excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "INPUT",
            "id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[5]/input[1]"
            },
            "excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "BUTTON",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]"
            },
            "excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj\" data-custom-id=\"nxouluvbretczsumlwfttgzfltqnntvlwvaf\"> <span class=\"brz-span brz-text__editor\"> SUBMIT </span> <svg version=\"1.1\" xmlns=\"http://www ... ull;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,... </script> </g> </svg> </button>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\"> <span class=\"brz-span brz-text__editor\"> Learn More </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "INPUT",
            "id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[1]/input[1]"
            },
            "excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "INPUT",
            "id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[2]/input[1]"
            },
            "excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "INPUT",
            "id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[3]/input[1]"
            },
            "excerpt": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\..."
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "INPUT",
            "id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[4]/input[1]"
            },
            "excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "BUTTON",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[5]/button[1]"
            },
            "excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-dyvgx\" data-custom-id=\"pctxnochcdlwubleyhhicvdleifnqiyrttuh\"> <span class=\"brz-span brz-text__editor\"> Endorse Joe! </span> <svg version=\"1. ... ull;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,... </script> </g> </svg> </button>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Home </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Meet Joe </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> News </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> AD5 </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Issues </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "INPUT",
            "id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[1]/input[1]"
            },
            "excerpt": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\..."
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "BUTTON",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[2]/button[1]"
            },
            "excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-rplcf\" data-custom-id=\"urngpgulgkggkfoivjalbjunpabjeeujtqmh\"> <span class=\"brz-span brz-text__editor\"> SUBMIT </span> <svg version=\"1.1\" xml ... ull;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,... </script> </g> </svg> </button>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span brz-icon css-1yqt0eo\"> <svg version=\"1.1 ... 659-4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\"></path... </g> </svg> </span> </a>"
          },
          {
            "ruleID": "r65",
            "what": "Element in sequential focus order has visible focus",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span brz-icon css-1ldonqd\"> <svg version=\"1.1\" xmlns=\"http:/ ... 6-1.6 c-2.7,0-4.9,2.2-4.9,4.9c0,0.4,0,0.8,0.1,1.1C7.7,8.1,4.1,6.1,1.7,3.1C1.2,3.9,1,4.7,1,5.6c0,1.7,0.9,3.2,2.2,4.1 C2.4,9.7,1.6,9.5,1,9.1c0,0,0,0,0,0.1c0,2.4,1.7,4.4,3.9,4... </g> </svg> </span> </a>"
          },
          {
            "ruleID": "r66",
            "what": "Text outside widget has enhanced contrast",
            "ordinalSeverity": 0,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
            },
            "excerpt": "THANK YOU!"
          },
          {
            "ruleID": "r66",
            "what": "Text outside widget has enhanced contrast",
            "ordinalSeverity": 0,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]"
            },
            "excerpt": "Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
          },
          {
            "ruleID": "r66",
            "what": "Text outside widget has enhanced contrast",
            "ordinalSeverity": 0,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]"
            },
            "excerpt": "-Joe Patterson"
          },
          {
            "ruleID": "r66",
            "what": "Text outside widget has enhanced contrast",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]/span[1]/text()[1]"
            },
            "excerpt": "SUBMIT"
          },
          {
            "ruleID": "r66",
            "what": "Text outside widget has enhanced contrast",
            "ordinalSeverity": 0,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
            },
            "excerpt": "Meet Joe Patterson"
          },
          {
            "ruleID": "r66",
            "what": "Text outside widget has enhanced contrast",
            "ordinalSeverity": 0,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]"
            },
            "excerpt": "Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
          },
          {
            "ruleID": "r69",
            "what": "Text outside widget has minimum contrast",
            "ordinalSeverity": 0,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
            },
            "excerpt": "THANK YOU!"
          },
          {
            "ruleID": "r69",
            "what": "Text outside widget has minimum contrast",
            "ordinalSeverity": 0,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]"
            },
            "excerpt": "Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
          },
          {
            "ruleID": "r69",
            "what": "Text outside widget has minimum contrast",
            "ordinalSeverity": 0,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]"
            },
            "excerpt": "-Joe Patterson"
          },
          {
            "ruleID": "r69",
            "what": "Text outside widget has minimum contrast",
            "ordinalSeverity": 0,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
            },
            "excerpt": "Meet Joe Patterson"
          },
          {
            "ruleID": "r69",
            "what": "Text outside widget has minimum contrast",
            "ordinalSeverity": 0,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]"
            },
            "excerpt": "Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
          },
          {
            "ruleID": "r71",
            "what": "Paragraphs of text are not justified",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]"
            },
            "excerpt": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"> <span class=\"brz-cp-color3\"> Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span> </p>"
          },
          {
            "ruleID": "r73",
            "what": "Paragraphs of text have sufficient line height",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\"> <span class=\"brz-cp-color3\"> THANK YOU! </span> </p>"
          },
          {
            "ruleID": "r73",
            "what": "Paragraphs of text have sufficient line height",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]"
            },
            "excerpt": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"> <span class=\"brz-cp-color3\"> Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span> </p>"
          },
          {
            "ruleID": "r73",
            "what": "Paragraphs of text have sufficient line height",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]"
            },
            "excerpt": "<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\"> <span class=\"brz-cp-color3\"> -Joe Patterson </span> </p>"
          },
          {
            "ruleID": "r73",
            "what": "Paragraphs of text have sufficient line height",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\"> <span class=\"brz-cp-color1\"> Meet Joe Patterson </span> </p>"
          },
          {
            "ruleID": "r74",
            "what": "Paragraphs of text do not have font sizes defined in absolute units",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\"> <span class=\"brz-cp-color3\"> THANK YOU! </span> </p>"
          },
          {
            "ruleID": "r74",
            "what": "Paragraphs of text do not have font sizes defined in absolute units",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]"
            },
            "excerpt": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"> <span class=\"brz-cp-color3\"> Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span> </p>"
          },
          {
            "ruleID": "r74",
            "what": "Paragraphs of text do not have font sizes defined in absolute units",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]"
            },
            "excerpt": "<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\"> <span class=\"brz-cp-color3\"> -Joe Patterson </span> </p>"
          },
          {
            "ruleID": "r74",
            "what": "Paragraphs of text do not have font sizes defined in absolute units",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\"> <span class=\"brz-cp-color1\"> Meet Joe Patterson </span> </p>"
          },
          {
            "ruleID": "r74",
            "what": "Paragraphs of text do not have font sizes defined in absolute units",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\"> Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, w... </p>"
          },
          {
            "ruleID": "r87",
            "what": "First focusable element is link to main content",
            "ordinalSeverity": 0,
            "tagName": "",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/"
            },
            "excerpt": "#document <!doctype html> ... </html>"
          }
        ]
      },
      "endTime": 1687099513397
    },
    {
      "type": "test",
      "which": "axe",
      "detailLevel": 2,
      "startTime": 1687099513397,
      "url": "https://joepatterson.com/",
      "what": "Axe",
      "result": {
        "totals": {
          "rulesNA": 64,
          "rulesPassed": 32,
          "rulesWarned": 2,
          "rulesViolated": 8,
          "warnings": {
            "minor": 13,
            "moderate": 0,
            "serious": 11,
            "critical": 0
          },
          "violations": {
            "minor": 2,
            "moderate": 23,
            "serious": 4,
            "critical": 1
          }
        },
        "details": {
          "testEngine": {
            "name": "axe-core",
            "version": "4.7.0"
          },
          "testRunner": {
            "name": "axe"
          },
          "testEnvironment": {
            "userAgent": "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) HeadlessChrome/113.0.5672.53 Safari/537.36",
            "windowWidth": 1280,
            "windowHeight": 720,
            "orientationAngle": 90,
            "orientationType": "landscape-primary"
          },
          "timestamp": "2023-06-18T14:45:13.960Z",
          "url": "https://joepatterson.com/",
          "toolOptions": {
            "resultTypes": [
              "violations",
              "incomplete"
            ],
            "runOnly": {
              "type": "tag",
              "values": [
                "experimental",
                "best-practice",
                "wcag2a",
                "wcag2aa",
                "wcag2aaa",
                "wcag21a",
                "wcag21aa",
                "wcag21aaa"
              ]
            },
            "reporter": "v1"
          },
          "incomplete": [
            {
              "id": "color-contrast",
              "impact": "serious",
              "tags": [
                "cat.color",
                "wcag2aa",
                "wcag143",
                "ACT",
                "TTv5",
                "TT13.c"
              ],
              "description": "Ensures the contrast between foreground and background colors meets WCAG 2 AA minimum contrast ratio thresholds",
              "help": "Elements must meet minimum color contrast ratio thresholds",
              "helpUrl": "https://dequeuniversity.com/rules/axe/4.7/color-contrast?application=axeAPI",
              "nodes": [
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "34.5pt (46px)",
                        "fontWeight": "bold",
                        "messageKey": "bgGradient",
                        "expectedContrastRatio": "3:1"
                      },
                      "relatedNodes": [
                        {
                          "html": "<div class=\"brz-bg-color\"></div>",
                          "target": [
                            ".brz-css-miyhv > .brz-bg > .brz-bg-color"
                          ]
                        }
                      ],
                      "impact": "serious",
                      "message": "Element's background color could not be determined due to a background gradient"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<span class=\"brz-cp-color3\">THANK YOU!</span>",
                  "target": [
                    ".brz-css-mntwc > .brz-cp-color3"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined due to a background gradient"
                },
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "21.0pt (28px)",
                        "fontWeight": "bold",
                        "messageKey": "elmPartiallyObscuring",
                        "expectedContrastRatio": "3:1"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element's background color could not be determined because it partially overlaps other elements"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>",
                  "target": [
                    ".brz-css-aesxw > .brz-cp-color3"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined because it partially overlaps other elements"
                },
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "21.0pt (28px)",
                        "fontWeight": "bold",
                        "messageKey": "bgGradient",
                        "expectedContrastRatio": "3:1"
                      },
                      "relatedNodes": [
                        {
                          "html": "<div class=\"brz-bg-color\"></div>",
                          "target": [
                            ".brz-css-miyhv > .brz-bg > .brz-bg-color"
                          ]
                        }
                      ],
                      "impact": "serious",
                      "message": "Element's background color could not be determined due to a background gradient"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<span class=\"brz-cp-color3\">-Joe Patterson </span>",
                  "target": [
                    ".brz-css-swhqo > .brz-cp-color3"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined due to a background gradient"
                },
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "63.0pt (84px)",
                        "fontWeight": "bold",
                        "messageKey": "bgGradient",
                        "expectedContrastRatio": "3:1"
                      },
                      "relatedNodes": [
                        {
                          "html": "<div class=\"brz-bg-color\"></div>",
                          "target": [
                            ".brz-css-miyhv > .brz-bg > .brz-bg-color"
                          ]
                        }
                      ],
                      "impact": "serious",
                      "message": "Element's background color could not be determined due to a background gradient"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>",
                  "target": [
                    ".brz-css-lkuyo > strong"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined due to a background gradient"
                },
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "33.0pt (44px)",
                        "fontWeight": "bold",
                        "messageKey": "bgOverlap",
                        "expectedContrastRatio": "3:1"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element's background color could not be determined because it is overlapped by another element"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>",
                  "target": [
                    ".brz-scp-color2.brz-cp-color8"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined because it is overlapped by another element"
                },
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "34.5pt (46px)",
                        "fontWeight": "bold",
                        "messageKey": "bgOverlap",
                        "expectedContrastRatio": "3:1"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element's background color could not be determined because it is overlapped by another element"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>",
                  "target": [
                    ".brz-css-dbkfe > .brz-cp-color8"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined because it is overlapped by another element"
                },
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "13.5pt (18px)",
                        "fontWeight": "bold",
                        "messageKey": "bgOverlap",
                        "expectedContrastRatio": "4.5:1"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element's background color could not be determined because it is overlapped by another element"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                  "target": [
                    "#jzrufgnrfzecnjmtttonuyghestufadxldym"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined because it is overlapped by another element"
                },
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "13.5pt (18px)",
                        "fontWeight": "bold",
                        "messageKey": "bgOverlap",
                        "expectedContrastRatio": "4.5:1"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element's background color could not be determined because it is overlapped by another element"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                  "target": [
                    "#mclycssgwgofzkypsbsvkaswqtjdgpvowhhz"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined because it is overlapped by another element"
                },
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "13.5pt (18px)",
                        "fontWeight": "bold",
                        "messageKey": "bgOverlap",
                        "expectedContrastRatio": "4.5:1"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element's background color could not be determined because it is overlapped by another element"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>",
                  "target": [
                    "#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined because it is overlapped by another element"
                },
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "13.5pt (18px)",
                        "fontWeight": "bold",
                        "messageKey": "bgOverlap",
                        "expectedContrastRatio": "4.5:1"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element's background color could not be determined because it is overlapped by another element"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                  "target": [
                    "#oijylgskfpupythmpgcgqnojnxwotrblubel"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined because it is overlapped by another element"
                },
                {
                  "any": [
                    {
                      "id": "color-contrast",
                      "data": {
                        "contrastRatio": 0,
                        "fontSize": "13.5pt (18px)",
                        "fontWeight": "bold",
                        "messageKey": "bgOverlap",
                        "expectedContrastRatio": "4.5:1"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element's background color could not be determined because it is overlapped by another element"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                  "target": [
                    "#cbowzefbgrpgocofetojkemunbeanmiuuxiw"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element's background color could not be determined because it is overlapped by another element"
                }
              ]
            },
            {
              "id": "hidden-content",
              "impact": "minor",
              "tags": [
                "cat.structure",
                "experimental",
                "review-item",
                "best-practice"
              ],
              "description": "Informs users about hidden content.",
              "help": "Hidden content on the page should be analyzed",
              "helpUrl": "https://dequeuniversity.com/rules/axe/4.7/hidden-content?application=axeAPI",
              "nodes": [
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<nav id=\"asmnvqfvmmootnluikvnozrkjelxspuhkucy\" class=\"brz-menu brz-menu__mmenu brz-menu--has-dropdown brz-menu__preview brz-css-fpfjx brz-css-wjjfv brz-mm-menu brz-mm-menu_offcanvas brz-mm-menu_theme-dark brz-mm-menu_pagedim-black brz-mm-menu_border-full brz-mm-menu_position-front brz-mm-menu_position-left\" aria-hidden=\"true\">",
                  "target": [
                    "#asmnvqfvmmootnluikvnozrkjelxspuhkucy"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<div id=\"mm-2\" class=\"brz-mm-panel brz-mm-hidden\" aria-hidden=\"true\">",
                  "target": [
                    "#mm-2"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22%2C%22tablet%22%3A%22bottom-start%22%2C%22mobile%22%3A%22bottom-start%22%7D%7D\" class=\"brz-menu__dropdown brz-menu__sub-menu\" style=\"--offset: 5px; position: absolute; inset: 0px auto auto 0px; margin: 0px; transform: translate(0px, 44px);\" data-popper-placement=\"bottom-start\">",
                  "target": [
                    "ul[data-popper-placement=\"bottom-start\"]"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<div class=\"brz-mm-menu__icon\">",
                  "target": [
                    ".brz-mm-menu__icon"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<div class=\"brz-css-aebhg brz-css-qezxz brz-wrapper\">",
                  "target": [
                    ".brz-css-qezxz"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-uyuor\" id=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-brz-popup=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-click_outside_to_close=\"true\" data-custom-id=\"ikypnpgzhasdbsxyczhyhiktepvcivqziwaf\">",
                  "target": [
                    "#wziehoicgkyratljhitjiidxmxjsagxhbsyb"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<section data-uid=\"dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq\" id=\"dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq\" class=\"brz-section brz-css-czgqm brz-css-dqvpp\">",
                  "target": [
                    "#dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
                  "target": [
                    "form[data-success=\"\"][data-error=\"\"][data-redirect=\"/confirmation/\"] > .brz-forms2__item-button.brz-forms2.brz-forms2__item > button > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
                  "target": [
                    ".brz-css-dyvgx > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22%2C%22tablet%22%3A%22bottom-start%22%2C%22mobile%22%3A%22bottom-start%22%7D%7D\" class=\"brz-menu__dropdown brz-menu__sub-menu\" style=\"--offset: 5px; position: absolute; inset: auto auto 0px 0px; margin: 0px; transform: translate(0px, -43px);\" data-popper-reference-hidden=\"\" data-popper-escaped=\"\" data-popper-placement=\"top-start\">",
                  "target": [
                    "ul[data-popper-reference-hidden=\"\"]"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
                  "target": [
                    ".brz-css-rplcf > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<div class=\"brz-mm-wrapper__blocker brz-mm-slideout\"><a href=\"#mm-0\"><span class=\"brz-mm-sronly\">Close menu</span></a></div>",
                  "target": [
                    ".brz-mm-wrapper__blocker"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                },
                {
                  "any": [
                    {
                      "id": "hidden-content",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-coyvp\" id=\"gfvfkzeiseiarwaanpeufzkocrfwprktavbj\" data-brz-popup=\"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-click_outside_to_close=\"true\" data-custom-id=\"zvpudqmsabbezjvlgveuzqjicfdsinhpicia\">",
                  "target": [
                    "#gfvfkzeiseiarwaanpeufzkocrfwprktavbj"
                  ],
                  "failureSummary": "Fix any of the following:\n  There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
                }
              ]
            }
          ],
          "violations": [
            {
              "id": "color-contrast-enhanced",
              "impact": "serious",
              "tags": [
                "cat.color",
                "wcag2aaa",
                "wcag146",
                "ACT"
              ],
              "description": "Ensures the contrast between foreground and background colors meets WCAG 2 AAA enhanced contrast ratio thresholds",
              "help": "Elements must meet enhanced color contrast ratio thresholds",
              "helpUrl": "https://dequeuniversity.com/rules/axe/4.7/color-contrast-enhanced?application=axeAPI",
              "nodes": [
                {
                  "any": [
                    {
                      "id": "color-contrast-enhanced",
                      "data": {
                        "fgColor": "#ffffff",
                        "bgColor": "#e1251b",
                        "contrastRatio": 4.68,
                        "fontSize": "11.3pt (15px)",
                        "fontWeight": "bold",
                        "messageKey": null,
                        "expectedContrastRatio": "7:1"
                      },
                      "relatedNodes": [
                        {
                          "html": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj\" data-custom-id=\"nxouluvbretczsumlwfttgzfltqnntvlwvaf\">",
                          "target": [
                            "form[data-success=\"\"][data-error=\"\"][data-redirect=\"/confirmation/\"] > .brz-forms2__item-button.brz-forms2.brz-forms2__item > button"
                          ]
                        }
                      ],
                      "impact": "serious",
                      "message": "Element has insufficient color contrast of 4.68 (foreground color: #ffffff, background color: #e1251b, font size: 11.3pt (15px), font weight: bold). Expected contrast ratio of 7:1"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "serious",
                  "html": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>",
                  "target": [
                    "form[data-success=\"\"][data-error=\"\"][data-redirect=\"/confirmation/\"] > .brz-forms2__item-button.brz-forms2.brz-forms2__item > button > .brz-text__editor.brz-span"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element has insufficient color contrast of 4.68 (foreground color: #ffffff, background color: #e1251b, font size: 11.3pt (15px), font weight: bold). Expected contrast ratio of 7:1"
                }
              ]
            },
            {
              "id": "duplicate-id",
              "impact": "minor",
              "tags": [
                "cat.parsing",
                "wcag2a",
                "wcag411"
              ],
              "description": "Ensures every id attribute value is unique",
              "help": "id attribute value must be unique",
              "helpUrl": "https://dequeuniversity.com/rules/axe/4.7/duplicate-id?application=axeAPI",
              "nodes": [
                {
                  "any": [
                    {
                      "id": "duplicate-id",
                      "data": "close-popup",
                      "relatedNodes": [
                        {
                          "html": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">",
                          "target": [
                            ".brz-css-jyuit > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"]"
                          ]
                        }
                      ],
                      "impact": "minor",
                      "message": "Document has multiple static elements with the same id attribute: close-popup"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">",
                  "target": [
                    ".brz-css-puutg > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"]"
                  ],
                  "failureSummary": "Fix any of the following:\n  Document has multiple static elements with the same id attribute: close-popup"
                },
                {
                  "any": [
                    {
                      "id": "duplicate-id",
                      "data": "Line-2",
                      "relatedNodes": [
                        {
                          "html": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
                          "target": [
                            ".brz-css-puutg > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"] > path[stroke=\"currentColor\"][fill-rule=\"nonzero\"]:nth-child(2)"
                          ]
                        },
                        {
                          "html": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
                          "target": [
                            ".brz-css-jyuit > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"] > path[stroke=\"currentColor\"][fill-rule=\"nonzero\"]:nth-child(1)"
                          ]
                        },
                        {
                          "html": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
                          "target": [
                            ".brz-css-jyuit > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"] > path[stroke=\"currentColor\"][fill-rule=\"nonzero\"]:nth-child(2)"
                          ]
                        }
                      ],
                      "impact": "minor",
                      "message": "Document has multiple static elements with the same id attribute: Line-2"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "minor",
                  "html": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
                  "target": [
                    ".brz-css-puutg > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"] > path[stroke=\"currentColor\"][fill-rule=\"nonzero\"]:nth-child(1)"
                  ],
                  "failureSummary": "Fix any of the following:\n  Document has multiple static elements with the same id attribute: Line-2"
                }
              ]
            },
            {
              "id": "image-alt",
              "impact": "critical",
              "tags": [
                "cat.text-alternatives",
                "wcag2a",
                "wcag111",
                "section508",
                "section508.22.a",
                "ACT",
                "TTv5",
                "TT7.a",
                "TT7.b"
              ],
              "description": "Ensures <img> elements have alternate text or a role of none or presentation",
              "help": "Images must have alternate text",
              "helpUrl": "https://dequeuniversity.com/rules/axe/4.7/image-alt?application=axeAPI",
              "nodes": [
                {
                  "any": [
                    {
                      "id": "has-alt",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "critical",
                      "message": "Element does not have an alt attribute"
                    },
                    {
                      "id": "aria-label",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "aria-label attribute does not exist or is empty"
                    },
                    {
                      "id": "aria-labelledby",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty"
                    },
                    {
                      "id": "non-empty-title",
                      "data": {
                        "messageKey": "noAttr"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element has no title attribute"
                    },
                    {
                      "id": "presentational-role",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "Element's default semantics were not overridden with role=\"none\" or role=\"presentation\""
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "critical",
                  "html": "<img src=\"http://ib.adnxs.com/seg?add=30067132&amp;t=2\" width=\"1\" height=\"1\">",
                  "target": [
                    "img[width=\"1\"]"
                  ],
                  "failureSummary": "Fix any of the following:\n  Element does not have an alt attribute\n  aria-label attribute does not exist or is empty\n  aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty\n  Element has no title attribute\n  Element's default semantics were not overridden with role=\"none\" or role=\"presentation\""
                }
              ]
            },
            {
              "id": "landmark-one-main",
              "impact": "moderate",
              "tags": [
                "cat.semantics",
                "best-practice"
              ],
              "description": "Ensures the document has a main landmark",
              "help": "Document should have one main landmark",
              "helpUrl": "https://dequeuniversity.com/rules/axe/4.7/landmark-one-main?application=axeAPI",
              "nodes": [
                {
                  "any": [],
                  "all": [
                    {
                      "id": "page-has-main",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Document does not have a main landmark"
                    }
                  ],
                  "none": [],
                  "impact": "moderate",
                  "html": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\">",
                  "target": [
                    "html"
                  ],
                  "failureSummary": "Fix all of the following:\n  Document does not have a main landmark"
                }
              ]
            },
            {
              "id": "landmark-unique",
              "impact": "moderate",
              "tags": [
                "cat.semantics",
                "best-practice"
              ],
              "help": "Ensures landmarks are unique",
              "description": "Landmarks should have a unique role or role/label/title (i.e. accessible name) combination",
              "helpUrl": "https://dequeuniversity.com/rules/axe/4.7/landmark-unique?application=axeAPI",
              "nodes": [
                {
                  "any": [
                    {
                      "id": "landmark-is-unique",
                      "data": {
                        "role": "navigation",
                        "accessibleText": null
                      },
                      "relatedNodes": [
                        {
                          "html": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\">",
                          "target": [
                            ".brz-css-hasdy"
                          ]
                        }
                      ],
                      "impact": "moderate",
                      "message": "The landmark must have a unique aria-label, aria-labelledby, or title to make landmarks distinguishable"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\">",
                  "target": [
                    ".brz-css-nxfqt > .brz-css-wjjfv"
                  ],
                  "failureSummary": "Fix any of the following:\n  The landmark must have a unique aria-label, aria-labelledby, or title to make landmarks distinguishable"
                }
              ]
            },
            {
              "id": "link-name",
              "impact": "serious",
              "tags": [
                "cat.name-role-value",
                "wcag2a",
                "wcag412",
                "wcag244",
                "section508",
                "section508.22.a",
                "ACT",
                "TTv5",
                "TT6.a"
              ],
              "description": "Ensures links have discernible text",
              "help": "Links must have discernible text",
              "helpUrl": "https://dequeuniversity.com/rules/axe/4.7/link-name?application=axeAPI",
              "nodes": [
                {
                  "any": [
                    {
                      "id": "has-visible-text",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "Element does not have text that is visible to screen readers"
                    },
                    {
                      "id": "aria-label",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "aria-label attribute does not exist or is empty"
                    },
                    {
                      "id": "aria-labelledby",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty"
                    },
                    {
                      "id": "non-empty-title",
                      "data": {
                        "messageKey": "noAttr"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element has no title attribute"
                    }
                  ],
                  "all": [],
                  "none": [
                    {
                      "id": "focusable-no-name",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element is in tab order and does not have accessible text"
                    }
                  ],
                  "impact": "serious",
                  "html": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\">",
                  "target": [
                    ".brz-css-yauhe > .brz-a[href$=\"joepatterson.com/\"][data-brz-link-type=\"external\"]"
                  ],
                  "failureSummary": "Fix all of the following:\n  Element is in tab order and does not have accessible text\n\nFix any of the following:\n  Element does not have text that is visible to screen readers\n  aria-label attribute does not exist or is empty\n  aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty\n  Element has no title attribute"
                },
                {
                  "any": [
                    {
                      "id": "has-visible-text",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "Element does not have text that is visible to screen readers"
                    },
                    {
                      "id": "aria-label",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "aria-label attribute does not exist or is empty"
                    },
                    {
                      "id": "aria-labelledby",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty"
                    },
                    {
                      "id": "non-empty-title",
                      "data": {
                        "messageKey": "noAttr"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element has no title attribute"
                    }
                  ],
                  "all": [],
                  "none": [
                    {
                      "id": "focusable-no-name",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element is in tab order and does not have accessible text"
                    }
                  ],
                  "impact": "serious",
                  "html": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
                  "target": [
                    "#gucekfcwzkwvwbcfqjgrflyvigkonlxuvqdd > .brz-icon__container > .brz-a[target=\"_blank\"][rel=\"noopener\"]"
                  ],
                  "failureSummary": "Fix all of the following:\n  Element is in tab order and does not have accessible text\n\nFix any of the following:\n  Element does not have text that is visible to screen readers\n  aria-label attribute does not exist or is empty\n  aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty\n  Element has no title attribute"
                },
                {
                  "any": [
                    {
                      "id": "has-visible-text",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "minor",
                      "message": "Element does not have text that is visible to screen readers"
                    },
                    {
                      "id": "aria-label",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "aria-label attribute does not exist or is empty"
                    },
                    {
                      "id": "aria-labelledby",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty"
                    },
                    {
                      "id": "non-empty-title",
                      "data": {
                        "messageKey": "noAttr"
                      },
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element has no title attribute"
                    }
                  ],
                  "all": [],
                  "none": [
                    {
                      "id": "focusable-no-name",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "serious",
                      "message": "Element is in tab order and does not have accessible text"
                    }
                  ],
                  "impact": "serious",
                  "html": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
                  "target": [
                    "a[href$=\"Patterdude\"]"
                  ],
                  "failureSummary": "Fix all of the following:\n  Element is in tab order and does not have accessible text\n\nFix any of the following:\n  Element does not have text that is visible to screen readers\n  aria-label attribute does not exist or is empty\n  aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty\n  Element has no title attribute"
                }
              ]
            },
            {
              "id": "page-has-heading-one",
              "impact": "moderate",
              "tags": [
                "cat.semantics",
                "best-practice"
              ],
              "description": "Ensure that the page, or at least one of its frames contains a level-one heading",
              "help": "Page should contain a level-one heading",
              "helpUrl": "https://dequeuniversity.com/rules/axe/4.7/page-has-heading-one?application=axeAPI",
              "nodes": [
                {
                  "any": [],
                  "all": [
                    {
                      "id": "page-has-heading-one",
                      "data": null,
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Page must have a level-one heading"
                    }
                  ],
                  "none": [],
                  "impact": "moderate",
                  "html": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\">",
                  "target": [
                    "html"
                  ],
                  "failureSummary": "Fix all of the following:\n  Page must have a level-one heading"
                }
              ]
            },
            {
              "id": "region",
              "impact": "moderate",
              "tags": [
                "cat.keyboard",
                "best-practice"
              ],
              "description": "Ensures all page content is contained by landmarks",
              "help": "All page content should be contained by landmarks",
              "helpUrl": "https://dequeuniversity.com/rules/axe/4.7/region?application=axeAPI",
              "nodes": [
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<img src=\"http://ib.adnxs.com/seg?add=30067132&amp;t=2\" width=\"1\" height=\"1\">",
                  "target": [
                    "img[width=\"1\"]"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-columns brz-css-pnewc brz-css-vjmzn\" data-custom-id=\"vwsaahrlenirosxrtdqzxlalcydssbntmwui\">",
                  "target": [
                    ".brz-css-vjmzn"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<span class=\"brz-span brz-text__editor\">DONATE</span>",
                  "target": [
                    ".brz-css-xufry > .brz-text__editor.brz-span"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-columns brz-css-pnewc brz-css-llegy\" data-custom-id=\"xhhnllzgngskrjccgozmqvlbgjhmedgxajds\">",
                  "target": [
                    ".brz-css-llegy"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-css-aebhg brz-css-lmjol brz-wrapper\">",
                  "target": [
                    ".brz-css-lmjol"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-css-aebhg brz-css-yfpby brz-wrapper\">",
                  "target": [
                    ".brz-css-yfpby"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<section data-uid=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" id=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" class=\"brz-section brz-css-czgqm\">",
                  "target": [
                    "#tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-columns brz-css-pnewc brz-css-jqfpe\" data-custom-id=\"yntkcgpmtcucqxkadnufyxwattcvnlhgeohq\">",
                  "target": [
                    ".brz-css-jqfpe"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-css-aebhg brz-css-ybzgg brz-wrapper\">",
                  "target": [
                    ".brz-css-ybzgg"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-gjenq\">",
                  "target": [
                    ".brz-css-gjenq"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-sqjjw\">",
                  "target": [
                    ".brz-css-sqjjw"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk\">",
                  "target": [
                    ".brz-css-pmcfe.brz-css-umcxw.brz-css-liimk:nth-child(3)"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-solsx\">",
                  "target": [
                    ".brz-css-solsx"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-xnabq\">",
                  "target": [
                    ".brz-css-xnabq"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<section data-uid=\"nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag\" id=\"nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag\" class=\"brz-section brz-css-czgqm brz-css-bnzyh\">",
                  "target": [
                    "#nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-css-aebhg brz-wrapper\">",
                  "target": [
                    ".brz-css-bxfnb > .brz-css-aebhg.brz-wrapper:nth-child(1)"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-ilwyl\">",
                  "target": [
                    ".brz-css-ilwyl"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-odtpn\">",
                  "target": [
                    ".brz-css-odtpn"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-fyenv\">",
                  "target": [
                    ".brz-css-fyenv"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                },
                {
                  "any": [
                    {
                      "id": "region",
                      "data": {
                        "isIframe": false
                      },
                      "relatedNodes": [],
                      "impact": "moderate",
                      "message": "Some page content is not contained by landmarks"
                    }
                  ],
                  "all": [],
                  "none": [],
                  "impact": "moderate",
                  "html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-cbrxq\">",
                  "target": [
                    ".brz-css-cbrxq"
                  ],
                  "failureSummary": "Fix any of the following:\n  Some page content is not contained by landmarks"
                }
              ]
            }
          ]
        },
        "success": true
      },
      "standardResult": {
        "totals": [
          13,
          11,
          25,
          5
        ],
        "instances": [
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined due to a background gradient",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-mntwc > .brz-cp-color3"
            },
            "excerpt": "<span class=\"brz-cp-color3\">THANK YOU!</span>"
          },
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it partially overlaps other elements",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-aesxw > .brz-cp-color3"
            },
            "excerpt": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>"
          },
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined due to a background gradient",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-swhqo > .brz-cp-color3"
            },
            "excerpt": "<span class=\"brz-cp-color3\">-Joe Patterson </span>"
          },
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined due to a background gradient",
            "ordinalSeverity": 1,
            "tagName": "STRONG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-lkuyo > strong"
            },
            "excerpt": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>"
          },
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-scp-color2.brz-cp-color8"
            },
            "excerpt": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>"
          },
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-dbkfe > .brz-cp-color8"
            },
            "excerpt": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>"
          },
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#jzrufgnrfzecnjmtttonuyghestufadxldym"
            },
            "excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#mclycssgwgofzkypsbsvkaswqtjdgpvowhhz"
            },
            "excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx"
            },
            "excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>"
          },
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#oijylgskfpupythmpgcgqnojnxwotrblubel"
            },
            "excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "color-contrast",
            "what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#cbowzefbgrpgocofetojkemunbeanmiuuxiw"
            },
            "excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "NAV",
            "id": "asmnvqfvmmootnluikvnozrkjelxspuhkucy",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#asmnvqfvmmootnluikvnozrkjelxspuhkucy"
            },
            "excerpt": "<nav id=\"asmnvqfvmmootnluikvnozrkjelxspuhkucy\" class=\"brz-menu brz-menu__mmenu brz-menu--has-dropdown brz-menu__preview brz-css-fpfjx brz-css-wjjfv brz-mm-menu brz-mm-menu_offcanvas brz-mm-menu_theme-dark brz-mm-menu_pagedim-black brz-mm-menu_border-full brz-mm-menu_position-front brz-mm-menu_position-left\" aria-hidden=\"true\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "DIV",
            "id": "mm-2",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#mm-2"
            },
            "excerpt": "<div id=\"mm-2\" class=\"brz-mm-panel brz-mm-hidden\" aria-hidden=\"true\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "UL",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "ul[data-popper-placement=\"bottom-start\"]"
            },
            "excerpt": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22% ... \" class=\"brz-menu__dropdown brz-menu__sub-menu\" style=\"--offset: 5px; position: absolute; inset: 0px auto auto 0px; margin: 0px; transform: translate(0px, 44px);\" data-popper-placement=\"bottom-start\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-mm-menu__icon"
            },
            "excerpt": "<div class=\"brz-mm-menu__icon\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-qezxz"
            },
            "excerpt": "<div class=\"brz-css-aebhg brz-css-qezxz brz-wrapper\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "DIV",
            "id": "wziehoicgkyratljhitjiidxmxjsagxhbsyb",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#wziehoicgkyratljhitjiidxmxjsagxhbsyb"
            },
            "excerpt": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-uyuor\" id=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-brz-popup=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-click_outside_to_close=\"true\" data-custom-id=\"ikypnpgzhasdbsxyczhyhiktepvcivqziwaf\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "SECTION",
            "id": "dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq"
            },
            "excerpt": "<section data-uid=\"dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq\" id=\"dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq\" class=\"brz-section brz-css-czgqm brz-css-dqvpp\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "form[data-success=\"\"][data-error=\"\"][data-redirect=\"/confirmation/\"] > .brz-forms2__item-button.brz-forms2.brz-forms2__item > button > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
            },
            "excerpt": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-dyvgx > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
            },
            "excerpt": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "UL",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "ul[data-popper-reference-hidden=\"\"]"
            },
            "excerpt": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22% ... =\"--offset: 5px; position: absolute; inset: auto auto 0px 0px; margin: 0px; transform: translate(0px, -43px);\" data-popper-reference-hidden=\"\" data-popper-escaped=\"\" data-popper-placement=\"top-start\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-rplcf > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
            },
            "excerpt": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-mm-wrapper__blocker"
            },
            "excerpt": "<div class=\"brz-mm-wrapper__blocker brz-mm-slideout\"><a href=\"#mm-0\"><span class=\"brz-mm-sronly\">Close menu</span></a></div>"
          },
          {
            "ruleID": "hidden-content",
            "what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
            "ordinalSeverity": 0,
            "tagName": "DIV",
            "id": "gfvfkzeiseiarwaanpeufzkocrfwprktavbj",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#gfvfkzeiseiarwaanpeufzkocrfwprktavbj"
            },
            "excerpt": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-coyvp\" id=\"gfvfkzeiseiarwaanpeufzkocrfwprktavbj\" data-brz-popup=\"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-click_outside_to_close=\"true\" data-custom-id=\"zvpudqmsabbezjvlgveuzqjicfdsinhpicia\">"
          },
          {
            "ruleID": "color-contrast-enhanced",
            "what": "Elements must meet enhanced color contrast ratio thresholds; Element has insufficient color contrast of 4.68 (foreground color: #ffffff, background color: #e1251b, font size: 11.3pt (15px), font weight: bold). Expected contrast ratio of 7:1",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "form[data-success=\"\"][data-error=\"\"][data-redirect=\"/confirmation/\"] > .brz-forms2__item-button.brz-forms2.brz-forms2__item > button > .brz-text__editor.brz-span"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>"
          },
          {
            "ruleID": "duplicate-id",
            "what": "id attribute value must be unique; Document has multiple static elements with the same id attribute: close-popup",
            "ordinalSeverity": 2,
            "tagName": "G",
            "id": "close-popup",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-puutg > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"]"
            },
            "excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">"
          },
          {
            "ruleID": "duplicate-id",
            "what": "id attribute value must be unique; Document has multiple static elements with the same id attribute: Line-2",
            "ordinalSeverity": 2,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-puutg > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"] > path[stroke=\"currentColor\"][fill-rule=\"nonzero\"]:nth-child(1)"
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
          },
          {
            "ruleID": "image-alt",
            "what": "Images must have alternate text; Element does not have an alt attribute; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute; Element's default semantics were not overridden with role=\"none\" or role=\"presentation\"",
            "ordinalSeverity": 3,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "img[width=\"1\"]"
            },
            "excerpt": "<img src=\"http://ib.adnxs.com/seg?add=30067132&amp;t=2\" width=\"1\" height=\"1\">"
          },
          {
            "ruleID": "landmark-one-main",
            "what": "Document should have one main landmark; Document does not have a main landmark",
            "ordinalSeverity": 2,
            "tagName": "HTML",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html"
            },
            "excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\">"
          },
          {
            "ruleID": "landmark-unique",
            "what": "Ensures landmarks are unique; The landmark must have a unique aria-label, aria-labelledby, or title to make landmarks distinguishable",
            "ordinalSeverity": 2,
            "tagName": "NAV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-nxfqt > .brz-css-wjjfv"
            },
            "excerpt": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\">"
          },
          {
            "ruleID": "link-name",
            "what": "Links must have discernible text; Element does not have text that is visible to screen readers; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-yauhe > .brz-a[href$=\"joepatterson.com/\"][data-brz-link-type=\"external\"]"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\">"
          },
          {
            "ruleID": "link-name",
            "what": "Links must have discernible text; Element does not have text that is visible to screen readers; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#gucekfcwzkwvwbcfqjgrflyvigkonlxuvqdd > .brz-icon__container > .brz-a[target=\"_blank\"][rel=\"noopener\"]"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">"
          },
          {
            "ruleID": "link-name",
            "what": "Links must have discernible text; Element does not have text that is visible to screen readers; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "a[href$=\"Patterdude\"]"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">"
          },
          {
            "ruleID": "page-has-heading-one",
            "what": "Page should contain a level-one heading; Page must have a level-one heading",
            "ordinalSeverity": 2,
            "tagName": "HTML",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html"
            },
            "excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "img[width=\"1\"]"
            },
            "excerpt": "<img src=\"http://ib.adnxs.com/seg?add=30067132&amp;t=2\" width=\"1\" height=\"1\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-vjmzn"
            },
            "excerpt": "<div class=\"brz-columns brz-css-pnewc brz-css-vjmzn\" data-custom-id=\"vwsaahrlenirosxrtdqzxlalcydssbntmwui\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-xufry > .brz-text__editor.brz-span"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">DONATE</span>"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-llegy"
            },
            "excerpt": "<div class=\"brz-columns brz-css-pnewc brz-css-llegy\" data-custom-id=\"xhhnllzgngskrjccgozmqvlbgjhmedgxajds\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-lmjol"
            },
            "excerpt": "<div class=\"brz-css-aebhg brz-css-lmjol brz-wrapper\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-yfpby"
            },
            "excerpt": "<div class=\"brz-css-aebhg brz-css-yfpby brz-wrapper\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "SECTION",
            "id": "tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq"
            },
            "excerpt": "<section data-uid=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" id=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" class=\"brz-section brz-css-czgqm\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-jqfpe"
            },
            "excerpt": "<div class=\"brz-columns brz-css-pnewc brz-css-jqfpe\" data-custom-id=\"yntkcgpmtcucqxkadnufyxwattcvnlhgeohq\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-ybzgg"
            },
            "excerpt": "<div class=\"brz-css-aebhg brz-css-ybzgg brz-wrapper\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-gjenq"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-gjenq\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-sqjjw"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-sqjjw\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-pmcfe.brz-css-umcxw.brz-css-liimk:nth-child(3)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-solsx"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-solsx\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-xnabq"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-xnabq\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "SECTION",
            "id": "nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "#nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag"
            },
            "excerpt": "<section data-uid=\"nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag\" id=\"nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag\" class=\"brz-section brz-css-czgqm brz-css-bnzyh\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-bxfnb > .brz-css-aebhg.brz-wrapper:nth-child(1)"
            },
            "excerpt": "<div class=\"brz-css-aebhg brz-wrapper\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-ilwyl"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-ilwyl\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-odtpn"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-odtpn\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-fyenv"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-fyenv\">"
          },
          {
            "ruleID": "region",
            "what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": ".brz-css-cbrxq"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-cbrxq\">"
          }
        ]
      },
      "endTime": 1687099513993
    },
    {
      "type": "launch",
      "which": "chromium",
      "startTime": 1687099513994,
      "endTime": 1687099514618
    },
    {
      "type": "url",
      "which": "https://joepatterson.com/",
      "what": "Candidate Joe Patterson (R)",
      "startTime": 1687099514619,
      "result": {
        "url": "https://joepatterson.com/"
      },
      "endTime": 1687099515487
    },
    {
      "type": "test",
      "which": "continuum",
      "startTime": 1687099515487,
      "url": "https://joepatterson.com/",
      "what": "Level Access Continuum, community edition",
      "result": [
        {
          "engineTestId": 89,
          "bestPracticeId": 362,
          "attribute": "This img element does not have a mechanism that allows an accessible name value to be calculated",
          "attributeDetail": "This img element does not have a mechanism that allows an accessible name value to be calculated",
          "element": "<img height=\"1\" width=\"1\" src=\"http://ib.adnxs.com/seg?add=30067132&amp;t=2\">",
          "path": "body>img:nth-of-type(1)",
          "fingerprint": {
            "version": 2,
            "css": "img[src=\"http://ib.adnxs.com/seg?add=30067132&t=2\"][width=\"1\"][height=\"1\"]",
            "attNo": 3
          }
        },
        {
          "engineTestId": 94,
          "bestPracticeId": 1352,
          "attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
          "attributeDetail": "This g has an id attribute of 'close-popup', which is not unique in the same DOM",
          "element": "<g stroke-linecap=\"square\" fill-rule=\"evenodd\" fill=\"none\" stroke-width=\"1\" stroke=\"none\" id=\"close-popup\"><path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.538404 ... path><path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path></g>",
          "path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "g[id=\"close-popup\"][stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"][fill-rule=\"evenodd\"][stroke-linecap=\"square\"]",
            "attNo": 6
          }
        },
        {
          "engineTestId": 94,
          "bestPracticeId": 1352,
          "attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
          "attributeDetail": "This g has an id attribute of 'close-popup', which is not unique in the same DOM",
          "element": "<g stroke-linecap=\"square\" fill-rule=\"evenodd\" fill=\"none\" stroke-width=\"1\" stroke=\"none\" id=\"close-popup\"><path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.538404 ... path><path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path></g>",
          "path": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "g[id=\"close-popup\"][stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"][fill-rule=\"evenodd\"][stroke-linecap=\"square\"]",
            "attNo": 6
          }
        },
        {
          "engineTestId": 94,
          "bestPracticeId": 1352,
          "attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
          "attributeDetail": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
          "element": "<path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>",
          "path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "path[d=\"M1.5,1.5 L14.5384048,14.5384048\"][id=\"Line-2\"][stroke=\"currentColor\"][fill-rule=\"nonzero\"]",
            "attNo": 4
          }
        },
        {
          "engineTestId": 94,
          "bestPracticeId": 1352,
          "attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
          "attributeDetail": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
          "element": "<path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>",
          "path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)",
          "fingerprint": {
            "version": 2,
            "css": "path[d=\"M1.5,1.5 L14.5384048,14.5384048\"][id=\"Line-2\"][stroke=\"currentColor\"][fill-rule=\"nonzero\"][transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"]",
            "attNo": 5
          }
        },
        {
          "engineTestId": 94,
          "bestPracticeId": 1352,
          "attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
          "attributeDetail": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
          "element": "<path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>",
          "path": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "path[d=\"M1.5,1.5 L14.5384048,14.5384048\"][id=\"Line-2\"][stroke=\"currentColor\"][fill-rule=\"nonzero\"]",
            "attNo": 4
          }
        },
        {
          "engineTestId": 94,
          "bestPracticeId": 1352,
          "attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
          "attributeDetail": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
          "element": "<path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>",
          "path": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)",
          "fingerprint": {
            "version": 2,
            "css": "path[d=\"M1.5,1.5 L14.5384048,14.5384048\"][id=\"Line-2\"][stroke=\"currentColor\"][fill-rule=\"nonzero\"][transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"]",
            "attNo": 5
          }
        },
        {
          "engineTestId": 123,
          "bestPracticeId": 362,
          "attribute": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
          "attributeDetail": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
          "element": "<svg data-name=\"tail-right\" data-type=\"glyph\" class=\"brz-icon-svg brz-css-oheuj\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w ... r\"><path d=\"M22.707,11.293L15,3.586L13.586,5l6,6H2c-0.553,0-1,0.448-1,1s0.447,1,1,1h17.586l-6,6L15,20.414 l7.707-7.707C23.098,12.316,23.098,11.684,22.707,11.293z\" fill=\"currentColor\"></path></g></svg>",
          "path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "svg[version=\"1.1\"][x=\"0px\"][y=\"0px\"][viewbox=\"0 0 24 24\"][class=\"brz-icon-svg brz-css-oheuj\"][data-type=\"glyph\"][data-name=\"tail-right\"]",
            "attNo": 10
          }
        },
        {
          "engineTestId": 123,
          "bestPracticeId": 362,
          "attribute": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
          "attributeDetail": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
          "element": "<svg data-name=\"quote-left\" data-type=\"fa\" class=\"brz-icon-svg\" viewbox=\"0 0 512 512\" xmlns=\"http://www.w3.org/2000/svg\"><path d=\"M464 256h-80v-64c0-35.3 28.7-64 64-64h8c13.3 0 24-10.7 24-24V56c0-13.3 ... 8zm-288 0H96v-64c0-35.3 28.7-64 64-64h8c13.3 0 24-10.7 24-24V56c0-13.3-10.7-24-24-24h-8C71.6 32 0 103.6 0 192v240c0 26.5 21.5 48 48 48h128c26.5 0 48-21.5 48-48V304c0-26.5-21.5-48-48-48z\"></path></svg>",
          "path": "body>div:nth-of-type(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "svg[viewbox=\"0 0 512 512\"][class=\"brz-icon-svg\"][data-type=\"fa\"][data-name=\"quote-left\"]",
            "attNo": 5
          }
        },
        {
          "engineTestId": 123,
          "bestPracticeId": 362,
          "attribute": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
          "attributeDetail": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
          "element": "<svg data-name=\"quote-right\" data-type=\"fa\" class=\"brz-icon-svg\" viewbox=\"0 0 512 512\" xmlns=\"http://www.w3.org/2000/svg\"><path d=\"M464 32H336c-26.5 0-48 21.5-48 48v128c0 26.5 21.5 48 48 48h80v64c0 35 ... 48zm-288 0H48C21.5 32 0 53.5 0 80v128c0 26.5 21.5 48 48 48h80v64c0 35.3-28.7 64-64 64h-8c-13.3 0-24 10.7-24 24v48c0 13.3 10.7 24 24 24h8c88.4 0 160-71.6 160-160V80c0-26.5-21.5-48-48-48z\"></path></svg>",
          "path": "body>div:nth-of-type(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "svg[viewbox=\"0 0 512 512\"][class=\"brz-icon-svg\"][data-type=\"fa\"][data-name=\"quote-right\"]",
            "attNo": 5
          }
        },
        {
          "engineTestId": 123,
          "bestPracticeId": 362,
          "attribute": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
          "attributeDetail": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
          "element": "<svg data-name=\"logo-facebook\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/ ... -4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\" fill=\"currentColor\"></path></g></svg>",
          "path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "svg[version=\"1.1\"][x=\"0px\"][y=\"0px\"][viewbox=\"0 0 24 24\"][class=\"brz-icon-svg\"][data-type=\"glyph\"][data-name=\"logo-facebook\"]",
            "attNo": 10
          }
        },
        {
          "engineTestId": 123,
          "bestPracticeId": 362,
          "attribute": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
          "attributeDetail": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
          "element": "<svg data-name=\"logo-twitter\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/s ... -0.1c0.6,2,2.4,3.4,4.6,3.4 c-1.7,1.3-3.8,2.1-6.1,2.1c-0.4,0-0.8,0-1.2-0.1c2.2,1.4,4.8,2.2,7.5,2.2c9.1,0,14-7.5,14-14c0-0.2,0-0.4,0-0.6 C22.5,6.4,23.3,5.5,24,4.6z\" fill=\"currentColor\"></path></g></svg>",
          "path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "svg[version=\"1.1\"][x=\"0px\"][y=\"0px\"][viewbox=\"0 0 24 24\"][class=\"brz-icon-svg\"][data-type=\"glyph\"][data-name=\"logo-twitter\"]",
            "attNo": 10
          }
        },
        {
          "engineTestId": 237,
          "bestPracticeId": 1301,
          "attribute": "This A element does not have a mechanism that allows an accessible name value to be calculated",
          "attributeDetail": "This A element does not have a mechanism that allows an accessible name value to be calculated",
          "element": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\"><picture class=\"brz-picture brz-d-block brz-p-relative brz-c ... z-css-ptqop\"><img loading=\"lazy\" draggable=\"false\" alt=\"\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" class=\"brz-img brz-img-svg\" decoding=\"async\"></picture></a>",
          "path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "a[class=\"brz-a\"][href=\"https://joepatterson.com/\"][data-brz-link-type=\"external\"][id=\"\"][data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"]",
            "attNo": 5
          }
        },
        {
          "engineTestId": 237,
          "bestPracticeId": 1301,
          "attribute": "This A element does not have a mechanism that allows an accessible name value to be calculated",
          "attributeDetail": "This A element does not have a mechanism that allows an accessible name value to be calculated",
          "element": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\"><span class=\"brz-span brz-icon css-1yqt0eo\"><svg data-name=\"log ... 25,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\" fill=\"currentColor\"></path></g></svg></span></a>",
          "path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "a[class=\"brz-a\"][href=\"https://www.facebook.com/PattersonForAssembly\"][target=\"_blank\"][rel=\"noopener\"][data-brz-link-type=\"external\"][id=\"\"]",
            "attNo": 6
          }
        },
        {
          "engineTestId": 237,
          "bestPracticeId": 1301,
          "attribute": "This A element does not have a mechanism that allows an accessible name value to be calculated",
          "attributeDetail": "This A element does not have a mechanism that allows an accessible name value to be calculated",
          "element": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\"><span class=\"brz-span brz-icon css-1ldonqd\"><svg data-name=\"logo-twitter\" data ... 2.4,3.4,4.6,3.4 c-1.7,1.3-3.8,2.1-6.1,2.1c-0.4,0-0.8,0-1.2-0.1c2.2,1.4,4.8,2.2,7.5,2.2c9.1,0,14-7.5,14-14c0-0.2,0-0.4,0-0.6 C22.5,6.4,23.3,5.5,24,4.6z\" fill=\"currentColor\"></path></g></svg></span></a>",
          "path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "a[class=\"brz-a\"][href=\"https://twitter.com/Patterdude\"][target=\"_blank\"][rel=\"noopener\"][data-brz-link-type=\"external\"][id=\"\"]",
            "attNo": 6
          }
        },
        {
          "engineTestId": 531,
          "bestPracticeId": 2519,
          "attribute": "This nav does not have a unique accessible name as required when two or more nav elements are present",
          "attributeDetail": "This nav does not have a unique accessible name as required when two or more nav elements are present",
          "element": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>",
          "path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "nav[class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"]",
            "attNo": 1
          }
        },
        {
          "engineTestId": 531,
          "bestPracticeId": 2519,
          "attribute": "This nav does not have a unique accessible name as required when two or more nav elements are present",
          "attributeDetail": "This nav does not have a unique accessible name as required when two or more nav elements are present",
          "element": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>",
          "path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "nav[class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"]",
            "attNo": 1
          }
        },
        {
          "engineTestId": 533,
          "bestPracticeId": 2519,
          "attribute": "This nav does not have an accessible name as required when two or more nav elements are present",
          "attributeDetail": "This nav does not have an accessible name as required when two or more nav elements are present",
          "element": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>",
          "path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "nav[class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"]",
            "attNo": 1
          }
        },
        {
          "engineTestId": 533,
          "bestPracticeId": 2519,
          "attribute": "This nav does not have an accessible name as required when two or more nav elements are present",
          "attributeDetail": "This nav does not have an accessible name as required when two or more nav elements are present",
          "element": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>",
          "path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "nav[class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"]",
            "attNo": 1
          }
        },
        {
          "engineTestId": 863,
          "bestPracticeId": 2440,
          "attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
          "attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
          "element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"First Name*\" data-label=\"First Name*\" data-type=\"Text\" required=\"\" placeholder=\"First Name*\" name=\"esdduiuzvslnnwyiw ... eholder=\"First Name*\" data-label=\"First Name*\" data-type=\"Text\" required=\"\" placeholder=\"First Name*\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" type=\"text\">",
          "path": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "input[type=\"text\"][id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\"][name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\"][placeholder=\"First Name*\"][required=\"\"][data-type=\"Text\"][data-label=\"First Name*\"][data-placeholder=\"First Name*\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
            "attNo": 9
          }
        },
        {
          "engineTestId": 863,
          "bestPracticeId": 2440,
          "attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
          "attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
          "element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Last Name*\" data-label=\"Last Name*\" data-type=\"Text\" required=\"\" placeholder=\"Last Name*\" name=\"rzfsrryoylspdpgnjcau ... laceholder=\"Last Name*\" data-label=\"Last Name*\" data-type=\"Text\" required=\"\" placeholder=\"Last Name*\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" type=\"text\">",
          "path": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "input[type=\"text\"][id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\"][name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\"][placeholder=\"Last Name*\"][required=\"\"][data-type=\"Text\"][data-label=\"Last Name*\"][data-placeholder=\"Last Name*\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
            "attNo": 9
          }
        },
        {
          "engineTestId": 863,
          "bestPracticeId": 2440,
          "attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
          "attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
          "element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email *\" data-label=\"Email *\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot; ... ,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email *\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" type=\"email\">",
          "path": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "input[type=\"email\"][id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\"][name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\"][placeholder=\"Email *\"][required=\"\"][pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@\\\"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@\\\"]+)*)|(\\\".+\\\"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\"][data-type=\"Email\"][data-label=\"Email *\"][data-placeholder=\"Email *\"][class=\"brz-input brz-forms2__field brz-forms2__field-email\"]",
            "attNo": 10
          }
        },
        {
          "engineTestId": 863,
          "bestPracticeId": 2440,
          "attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
          "attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
          "element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Cell Phone\" data-label=\"Cell Phone\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone\" name=\"uffubxyvtwxroutxldwp ... laceholder=\"Cell Phone\" data-label=\"Cell Phone\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" type=\"text\">",
          "path": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(4)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "input[type=\"text\"][id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\"][name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\"][placeholder=\"Cell Phone\"][required=\"\"][data-type=\"Text\"][data-label=\"Cell Phone\"][data-placeholder=\"Cell Phone\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
            "attNo": 9
          }
        },
        {
          "engineTestId": 863,
          "bestPracticeId": 2440,
          "attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
          "attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
          "element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Zip\" data-label=\"Zip\" data-type=\"Text\" required=\"\" placeholder=\"Zip\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" id= ... 2__field-text\" data-placeholder=\"Zip\" data-label=\"Zip\" data-type=\"Text\" required=\"\" placeholder=\"Zip\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" type=\"text\">",
          "path": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(5)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "input[type=\"text\"][id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\"][name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\"][placeholder=\"Zip\"][required=\"\"][data-type=\"Text\"][data-label=\"Zip\"][data-placeholder=\"Zip\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
            "attNo": 9
          }
        },
        {
          "engineTestId": 863,
          "bestPracticeId": 2440,
          "attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
          "attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
          "element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Name*\" data-label=\"Name*\" data-type=\"Text\" required=\"\" placeholder=\"Name*\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnm ... ld-text\" data-placeholder=\"Name*\" data-label=\"Name*\" data-type=\"Text\" required=\"\" placeholder=\"Name*\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" type=\"text\">",
          "path": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "input[type=\"text\"][id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\"][name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\"][placeholder=\"Name*\"][required=\"\"][data-type=\"Text\"][data-label=\"Name*\"][data-placeholder=\"Name*\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
            "attNo": 9
          }
        },
        {
          "engineTestId": 863,
          "bestPracticeId": 2440,
          "attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
          "attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
          "element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Title*\" data-label=\"Title*\" data-type=\"Text\" required=\"\" placeholder=\"Title*\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlv ... text\" data-placeholder=\"Title*\" data-label=\"Title*\" data-type=\"Text\" required=\"\" placeholder=\"Title*\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" type=\"text\">",
          "path": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "input[type=\"text\"][id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\"][name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\"][placeholder=\"Title*\"][required=\"\"][data-type=\"Text\"][data-label=\"Title*\"][data-placeholder=\"Title*\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
            "attNo": 9
          }
        },
        {
          "engineTestId": 863,
          "bestPracticeId": 2440,
          "attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
          "attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
          "element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email*\" data-label=\"Email*\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+ ... 1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email*\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" type=\"email\">",
          "path": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "input[type=\"email\"][id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\"][name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\"][placeholder=\"Email*\"][required=\"\"][pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@\\\"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@\\\"]+)*)|(\\\".+\\\"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\"][data-type=\"Email\"][data-label=\"Email*\"][data-placeholder=\"Email*\"][class=\"brz-input brz-forms2__field brz-forms2__field-email\"]",
            "attNo": 10
          }
        },
        {
          "engineTestId": 863,
          "bestPracticeId": 2440,
          "attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
          "attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
          "element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Cell Phone*\" data-label=\"Cell Phone*\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone*\" name=\"oluhpiqjxgvcswhkq ... eholder=\"Cell Phone*\" data-label=\"Cell Phone*\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone*\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" type=\"text\">",
          "path": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(4)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "input[type=\"text\"][id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\"][name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\"][placeholder=\"Cell Phone*\"][required=\"\"][data-type=\"Text\"][data-label=\"Cell Phone*\"][data-placeholder=\"Cell Phone*\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
            "attNo": 9
          }
        },
        {
          "engineTestId": 863,
          "bestPracticeId": 2440,
          "attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
          "attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
          "element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email Updates\" data-label=\"Email Updates\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\. ... 0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email Updates\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" type=\"email\">",
          "path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
          "fingerprint": {
            "version": 2,
            "css": "input[type=\"email\"][id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\"][name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\"][placeholder=\"Email Updates\"][required=\"\"][pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@\\\"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@\\\"]+)*)|(\\\".+\\\"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\"][data-type=\"Email\"][data-label=\"Email Updates\"][data-placeholder=\"Email Updates\"][class=\"brz-input brz-forms2__field brz-forms2__field-email\"]",
            "attNo": 10
          }
        }
      ],
      "standardResult": {
        "totals": [
          0,
          0,
          0,
          29
        ],
        "instances": [
          {
            "ruleID": "89",
            "what": "This img element does not have a mechanism that allows an accessible name value to be calculated",
            "ordinalSeverity": 3,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>img:nth-of-type(1)"
            },
            "excerpt": "<img height=\"1\" width=\"1\" src=\"http://ib.adnxs.com/seg?add=30067132&amp;t=2\">"
          },
          {
            "ruleID": "94",
            "what": "This g has an id attribute of 'close-popup', which is not unique in the same DOM",
            "ordinalSeverity": 3,
            "tagName": "G",
            "id": "close-popup",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<g stroke-linecap=\"square\" fill-rule=\"evenodd\" fill=\"none\" stroke-width=\"1\" stroke=\"none\" id=\"close-popup\"><path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.538404 ... path><path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path></g>"
          },
          {
            "ruleID": "94",
            "what": "This g has an id attribute of 'close-popup', which is not unique in the same DOM",
            "ordinalSeverity": 3,
            "tagName": "G",
            "id": "close-popup",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<g stroke-linecap=\"square\" fill-rule=\"evenodd\" fill=\"none\" stroke-width=\"1\" stroke=\"none\" id=\"close-popup\"><path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.538404 ... path><path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path></g>"
          },
          {
            "ruleID": "94",
            "what": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>"
          },
          {
            "ruleID": "94",
            "what": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)"
            },
            "excerpt": "<path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>"
          },
          {
            "ruleID": "94",
            "what": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>"
          },
          {
            "ruleID": "94",
            "what": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)"
            },
            "excerpt": "<path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>"
          },
          {
            "ruleID": "123",
            "what": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
            "ordinalSeverity": 3,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<svg data-name=\"tail-right\" data-type=\"glyph\" class=\"brz-icon-svg brz-css-oheuj\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w ... r\"><path d=\"M22.707,11.293L15,3.586L13.586,5l6,6H2c-0.553,0-1,0.448-1,1s0.447,1,1,1h17.586l-6,6L15,20.414 l7.707-7.707C23.098,12.316,23.098,11.684,22.707,11.293z\" fill=\"currentColor\"></path></g></svg>"
          },
          {
            "ruleID": "123",
            "what": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
            "ordinalSeverity": 3,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<svg data-name=\"quote-left\" data-type=\"fa\" class=\"brz-icon-svg\" viewbox=\"0 0 512 512\" xmlns=\"http://www.w3.org/2000/svg\"><path d=\"M464 256h-80v-64c0-35.3 28.7-64 64-64h8c13.3 0 24-10.7 24-24V56c0-13.3 ... 8zm-288 0H96v-64c0-35.3 28.7-64 64-64h8c13.3 0 24-10.7 24-24V56c0-13.3-10.7-24-24-24h-8C71.6 32 0 103.6 0 192v240c0 26.5 21.5 48 48 48h128c26.5 0 48-21.5 48-48V304c0-26.5-21.5-48-48-48z\"></path></svg>"
          },
          {
            "ruleID": "123",
            "what": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
            "ordinalSeverity": 3,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<svg data-name=\"quote-right\" data-type=\"fa\" class=\"brz-icon-svg\" viewbox=\"0 0 512 512\" xmlns=\"http://www.w3.org/2000/svg\"><path d=\"M464 32H336c-26.5 0-48 21.5-48 48v128c0 26.5 21.5 48 48 48h80v64c0 35 ... 48zm-288 0H48C21.5 32 0 53.5 0 80v128c0 26.5 21.5 48 48 48h80v64c0 35.3-28.7 64-64 64h-8c-13.3 0-24 10.7-24 24v48c0 13.3 10.7 24 24 24h8c88.4 0 160-71.6 160-160V80c0-26.5-21.5-48-48-48z\"></path></svg>"
          },
          {
            "ruleID": "123",
            "what": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
            "ordinalSeverity": 3,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<svg data-name=\"logo-facebook\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/ ... -4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\" fill=\"currentColor\"></path></g></svg>"
          },
          {
            "ruleID": "123",
            "what": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
            "ordinalSeverity": 3,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<svg data-name=\"logo-twitter\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/s ... -0.1c0.6,2,2.4,3.4,4.6,3.4 c-1.7,1.3-3.8,2.1-6.1,2.1c-0.4,0-0.8,0-1.2-0.1c2.2,1.4,4.8,2.2,7.5,2.2c9.1,0,14-7.5,14-14c0-0.2,0-0.4,0-0.6 C22.5,6.4,23.3,5.5,24,4.6z\" fill=\"currentColor\"></path></g></svg>"
          },
          {
            "ruleID": "237",
            "what": "This A element does not have a mechanism that allows an accessible name value to be calculated",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\"><picture class=\"brz-picture brz-d-block brz-p-relative brz-c ... z-css-ptqop\"><img loading=\"lazy\" draggable=\"false\" alt=\"\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" class=\"brz-img brz-img-svg\" decoding=\"async\"></picture></a>"
          },
          {
            "ruleID": "237",
            "what": "This A element does not have a mechanism that allows an accessible name value to be calculated",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\"><span class=\"brz-span brz-icon css-1yqt0eo\"><svg data-name=\"log ... 25,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\" fill=\"currentColor\"></path></g></svg></span></a>"
          },
          {
            "ruleID": "237",
            "what": "This A element does not have a mechanism that allows an accessible name value to be calculated",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\"><span class=\"brz-span brz-icon css-1ldonqd\"><svg data-name=\"logo-twitter\" data ... 2.4,3.4,4.6,3.4 c-1.7,1.3-3.8,2.1-6.1,2.1c-0.4,0-0.8,0-1.2-0.1c2.2,1.4,4.8,2.2,7.5,2.2c9.1,0,14-7.5,14-14c0-0.2,0-0.4,0-0.6 C22.5,6.4,23.3,5.5,24,4.6z\" fill=\"currentColor\"></path></g></svg></span></a>"
          },
          {
            "ruleID": "531",
            "what": "This nav does not have a unique accessible name as required when two or more nav elements are present",
            "ordinalSeverity": 3,
            "tagName": "NAV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>"
          },
          {
            "ruleID": "531",
            "what": "This nav does not have a unique accessible name as required when two or more nav elements are present",
            "ordinalSeverity": 3,
            "tagName": "NAV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>"
          },
          {
            "ruleID": "533",
            "what": "This nav does not have an accessible name as required when two or more nav elements are present",
            "ordinalSeverity": 3,
            "tagName": "NAV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>"
          },
          {
            "ruleID": "533",
            "what": "This nav does not have an accessible name as required when two or more nav elements are present",
            "ordinalSeverity": 3,
            "tagName": "NAV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>"
          },
          {
            "ruleID": "863",
            "what": "This input should not rely on text in the placeholder attribute for an accessible name",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"First Name*\" data-label=\"First Name*\" data-type=\"Text\" required=\"\" placeholder=\"First Name*\" name=\"esdduiuzvslnnwyiw ... eholder=\"First Name*\" data-label=\"First Name*\" data-type=\"Text\" required=\"\" placeholder=\"First Name*\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" type=\"text\">"
          },
          {
            "ruleID": "863",
            "what": "This input should not rely on text in the placeholder attribute for an accessible name",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)"
            },
            "excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Last Name*\" data-label=\"Last Name*\" data-type=\"Text\" required=\"\" placeholder=\"Last Name*\" name=\"rzfsrryoylspdpgnjcau ... laceholder=\"Last Name*\" data-label=\"Last Name*\" data-type=\"Text\" required=\"\" placeholder=\"Last Name*\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" type=\"text\">"
          },
          {
            "ruleID": "863",
            "what": "This input should not rely on text in the placeholder attribute for an accessible name",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)"
            },
            "excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email *\" data-label=\"Email *\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot; ... ,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email *\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" type=\"email\">"
          },
          {
            "ruleID": "863",
            "what": "This input should not rely on text in the placeholder attribute for an accessible name",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(4)>*:nth-child(1)"
            },
            "excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Cell Phone\" data-label=\"Cell Phone\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone\" name=\"uffubxyvtwxroutxldwp ... laceholder=\"Cell Phone\" data-label=\"Cell Phone\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" type=\"text\">"
          },
          {
            "ruleID": "863",
            "what": "This input should not rely on text in the placeholder attribute for an accessible name",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(5)>*:nth-child(1)"
            },
            "excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Zip\" data-label=\"Zip\" data-type=\"Text\" required=\"\" placeholder=\"Zip\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" id= ... 2__field-text\" data-placeholder=\"Zip\" data-label=\"Zip\" data-type=\"Text\" required=\"\" placeholder=\"Zip\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" type=\"text\">"
          },
          {
            "ruleID": "863",
            "what": "This input should not rely on text in the placeholder attribute for an accessible name",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Name*\" data-label=\"Name*\" data-type=\"Text\" required=\"\" placeholder=\"Name*\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnm ... ld-text\" data-placeholder=\"Name*\" data-label=\"Name*\" data-type=\"Text\" required=\"\" placeholder=\"Name*\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" type=\"text\">"
          },
          {
            "ruleID": "863",
            "what": "This input should not rely on text in the placeholder attribute for an accessible name",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)"
            },
            "excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Title*\" data-label=\"Title*\" data-type=\"Text\" required=\"\" placeholder=\"Title*\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlv ... text\" data-placeholder=\"Title*\" data-label=\"Title*\" data-type=\"Text\" required=\"\" placeholder=\"Title*\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" type=\"text\">"
          },
          {
            "ruleID": "863",
            "what": "This input should not rely on text in the placeholder attribute for an accessible name",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)"
            },
            "excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email*\" data-label=\"Email*\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+ ... 1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email*\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" type=\"email\">"
          },
          {
            "ruleID": "863",
            "what": "This input should not rely on text in the placeholder attribute for an accessible name",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(4)>*:nth-child(1)"
            },
            "excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Cell Phone*\" data-label=\"Cell Phone*\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone*\" name=\"oluhpiqjxgvcswhkq ... eholder=\"Cell Phone*\" data-label=\"Cell Phone*\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone*\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" type=\"text\">"
          },
          {
            "ruleID": "863",
            "what": "This input should not rely on text in the placeholder attribute for an accessible name",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
            },
            "excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email Updates\" data-label=\"Email Updates\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\. ... 0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email Updates\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" type=\"email\">"
          }
        ]
      },
      "endTime": 1687099515878
    },
    {
      "type": "launch",
      "which": "chromium",
      "startTime": 1687099515878,
      "endTime": 1687099516487
    },
    {
      "type": "url",
      "which": "https://joepatterson.com/",
      "what": "Candidate Joe Patterson (R)",
      "startTime": 1687099516487,
      "result": {
        "url": "https://joepatterson.com/"
      },
      "endTime": 1687099517402
    },
    {
      "type": "test",
      "which": "htmlcs",
      "startTime": 1687099517402,
      "url": "https://joepatterson.com/",
      "what": "HTML CodeSniffer WCAG 2.1 AA ruleset",
      "result": {
        "Error": {
          "AAA.1_1_1.H37": {
            "Img element missing an alt attribute. Use the alt attribute to specify a short text alternative.": [
              {
                "tagName": "img",
                "id": "",
                "code": "<img src=\"http://ib.adnxs.com/seg?add=30067132&amp;t=2\" width=\"1\" height=\"1\">"
              }
            ]
          },
          "AAA.1_3_1.F68": {
            "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.": [
              {
                "tagName": "input",
                "id": "#cbowzefbgrpgocofetojkemunbeanmiuuxiw",
                "code": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
                "code": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#jzrufgnrfzecnjmtttonuyghestufadxldym",
                "code": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
                "code": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#oijylgskfpupythmpgcgqnojnxwotrblubel",
                "code": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#xigbfawqysbbpzwgipmotfehpriwmghoorlv",
                "code": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#xzxcqjsxrqskvorhhphpxokryranycntgjrl",
                "code": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              }
            ]
          },
          "AAA.1_4_6.G17.Fail": {
            "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 1:1. Recommendation:  change text colour to #595959.": [
              {
                "tagName": "span",
                "id": "",
                "code": "<span class=\"brz-cp-color8 brz-pre-population-visible\">...</span>"
              },
              {
                "tagName": "span",
                "id": "",
                "code": "<span class=\"brz-cp-color8\">...</span>"
              }
            ],
            "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 4.69:1. Recommendation:  change background to #b40900.": [
              {
                "tagName": "span",
                "id": "",
                "code": "<span class=\"brz-span brz-text__editor\">...</span>"
              }
            ]
          },
          "AAA.1_4_6.G18.Fail": {
            "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation:  change text colour to #767676.": [
              {
                "tagName": "span",
                "id": "",
                "code": "<span class=\"brz-cp-color8\">...</span>"
              },
              {
                "tagName": "span",
                "id": "",
                "code": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">...</span>"
              },
              {
                "tagName": "span",
                "id": "",
                "code": "<span class=\"brz-span\">...</span>"
              },
              {
                "tagName": "strong",
                "id": "",
                "code": "<strong class=\"brz-cp-color8\">...</strong>"
              },
              {
                "tagName": "strong",
                "id": "",
                "code": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">...</strong>"
              }
            ]
          },
          "AAA.2_4_1.G1,G123,G124.NoSuchID": {
            "This link points to a named anchor \"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" within the document, but no anchor exists with that name.": [
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\">...</a>"
              }
            ]
          },
          "AAA.2_4_8.H59.1": {
            "Link elements can only be located in the head section of the document.": [
              {
                "tagName": "link",
                "id": "",
                "code": "<link class=\"brz-link brz-link-google-preconnect\" rel=\"preconnect\" href=\"https://fonts.gstatic.com/\" crossorigin=\"\">"
              },
              {
                "tagName": "link",
                "id": "",
                "code": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//ajax.googleapis.com\">"
              },
              {
                "tagName": "link",
                "id": "",
                "code": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">"
              },
              {
                "tagName": "link",
                "id": "",
                "code": "<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\">"
              },
              {
                "tagName": "link",
                "id": "",
                "code": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\">"
              },
              {
                "tagName": "link",
                "id": "",
                "code": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\">"
              }
            ]
          },
          "AAA.4_1_1.F77": {
            "Duplicate id attribute value \"close-popup\" found on the web page.": [
              {
                "tagName": "g",
                "id": "#close-popup",
                "code": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">...</g>"
              }
            ],
            "Duplicate id attribute value \"Line-2\" found on the web page.": [
              {
                "tagName": "path",
                "id": "#Line-2",
                "code": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \">...</path>"
              },
              {
                "tagName": "path",
                "id": "#Line-2",
                "code": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\">...</path>"
              }
            ]
          },
          "AAA.4_1_2.H91.A.NoContent": {
            "Anchor element found with a valid href attribute, but no link content has been supplied.": [
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
              }
            ]
          },
          "AAA.4_1_2.H91.InputEmail.Name": {
            "This emailinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.": [
              {
                "tagName": "input",
                "id": "#chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
                "code": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)"
              },
              {
                "tagName": "input",
                "id": "#mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
                "code": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)"
              },
              {
                "tagName": "input",
                "id": "#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
                "code": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)"
              }
            ]
          },
          "AAA.4_1_2.H91.InputText.Name": {
            "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.": [
              {
                "tagName": "input",
                "id": "#cbowzefbgrpgocofetojkemunbeanmiuuxiw",
                "code": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
                "code": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#jzrufgnrfzecnjmtttonuyghestufadxldym",
                "code": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
                "code": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#oijylgskfpupythmpgcgqnojnxwotrblubel",
                "code": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#xigbfawqysbbpzwgipmotfehpriwmghoorlv",
                "code": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              },
              {
                "tagName": "input",
                "id": "#xzxcqjsxrqskvorhhphpxokryranycntgjrl",
                "code": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
              }
            ]
          }
        },
        "Warning": {
          "AAA.1_1_1.H67.2": {
            "Img element is marked so that it is ignored by Assistive Technology.": [
              {
                "tagName": "img",
                "id": "",
                "code": "<img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_RedWhite.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
              },
              {
                "tagName": "img",
                "id": "",
                "code": "<img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
              },
              {
                "tagName": "img",
                "id": "",
                "code": "<img decoding=\"async\" class=\"brz-img\" srcset=\"https://joepatterson.com/wp-content/uploads/brizy/imgs/14138876_1728728670722916_1937653619668703721_o_1728728670722916-588x392x0x19x470x307x1641332718.jpg 1x, https://joepatterson.com/wp-content/uploads/brizy/imgs/14138876_1728728670722916_1937653619668703721_o_1728728670722916-1176x784x0x38x940x614x1641332718.jpg 2x\" src=\"https://joepatterson.com/wp-content/uploads/brizy/imgs/14138876_1728728670722916_1937653619668703721_o_1728728670722916-960x640x0x0x960x627x1641332718.jpg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
              }
            ]
          },
          "AAA.1_3_1.H42": {
            "Heading markup should be used if this content is intended as a heading.": [
              {
                "tagName": "p",
                "id": "",
                "code": "<p class=\"brz-css-bklfk\" data-uniq-id=\"qxpfh\" data-generated-css=\"brz-css-owucl\">...</p>"
              },
              {
                "tagName": "p",
                "id": "",
                "code": "<p class=\"brz-css-lkuyo\" data-generated-css=\"brz-css-kokqw\" data-uniq-id=\"hpxfi\">...</p>"
              }
            ]
          },
          "AAA.1_4_10.C32,C31,C33,C38,SCR34,G206": {
            "This element has \"position: fixed\". This may require scrolling in two dimensions, which is considered a failure of this Success Criterion.": [
              {
                "tagName": "div",
                "id": "#gfvfkzeiseiarwaanpeufzkocrfwprktavbj",
                "code": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-coyvp\" id=\"gfvfkzeiseiarwaanpeufzkocrfwprktavbj\" data-brz-popup=\"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-click_outside_to_close=\"true\" data-custom-id=\"zvpudqmsabbezjvlgveuzqjicfdsinhpicia\">...</div>"
              },
              {
                "tagName": "div",
                "id": "#wziehoicgkyratljhitjiidxmxjsagxhbsyb",
                "code": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-uyuor\" id=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-brz-popup=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-click_outside_to_close=\"true\" data-custom-id=\"ikypnpgzhasdbsxyczhyhiktepvcivqziwaf\">...</div>"
              },
              {
                "tagName": "div",
                "id": "",
                "code": "<div class=\"brz-mm-wrapper__blocker brz-mm-slideout\">...</div>"
              }
            ]
          },
          "AAA.1_4_3_F24.F24.FGColour": {
            "Check that this element has an inherited background colour or image to complement the corresponding inline foreground colour.": [
              {
                "tagName": "strong",
                "id": "",
                "code": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">...</strong>"
              }
            ]
          },
          "AAA.3_2_5.H83.3": {
            "Check that this link's link text contains information indicating that the link will open in a new window.": [
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-cbllz\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yemcvnewgngfymiotxewwyjzajhaeldnceah\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdggtybzbtscl\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurwjvjsywyumae\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufznyxypipympv\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
              },
              {
                "tagName": "a",
                "id": "",
                "code": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
              }
            ]
          }
        },
        "success": true
      },
      "standardResult": {
        "totals": [
          22,
          0,
          0,
          39
        ],
        "instances": [
          {
            "ruleID": "AAA.1_1_1.H67.2",
            "what": "Img element is marked so that it is ignored by Assistive Technology.",
            "ordinalSeverity": 0,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_RedWhite.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
          },
          {
            "ruleID": "AAA.1_1_1.H67.2",
            "what": "Img element is marked so that it is ignored by Assistive Technology.",
            "ordinalSeverity": 0,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
          },
          {
            "ruleID": "AAA.1_1_1.H67.2",
            "what": "Img element is marked so that it is ignored by Assistive Technology.",
            "ordinalSeverity": 0,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<img decoding=\"async\" class=\"brz-img\" srcset=\"https://joepatterson.com/wp-content/uploads/brizy/imgs/14138876_1728728670722916_1937653619668703721_o_1728728670722916-588x392x0x19x470x307x1641332718.jp ... rc=\"https://joepatterson.com/wp-content/uploads/brizy/imgs/14138876_1728728670722916_1937653619668703721_o_1728728670722916-960x640x0x0x960x627x1641332718.jpg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
          },
          {
            "ruleID": "AAA.1_3_1.H42",
            "what": "Heading markup should be used if this content is intended as a heading.",
            "ordinalSeverity": 0,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<p class=\"brz-css-bklfk\" data-uniq-id=\"qxpfh\" data-generated-css=\"brz-css-owucl\">...</p>"
          },
          {
            "ruleID": "AAA.1_3_1.H42",
            "what": "Heading markup should be used if this content is intended as a heading.",
            "ordinalSeverity": 0,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<p class=\"brz-css-lkuyo\" data-generated-css=\"brz-css-kokqw\" data-uniq-id=\"hpxfi\">...</p>"
          },
          {
            "ruleID": "AAA.1_4_10.C32,C31,C33,C38,SCR34,G206",
            "what": "This element has \"position: fixed\". This may require scrolling in two dimensions, which is considered a failure of this Success Criterion.",
            "ordinalSeverity": 0,
            "tagName": "DIV",
            "id": "gfvfkzeiseiarwaanpeufzkocrfwprktavbj",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-coyvp\" id=\"gfvfkzeiseiarwaanpeufzkocrfwprktavbj\" data-brz-popup=\"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-click_outside_to_close=\"true\" data-custom-id=\"zvpudqmsabbezjvlgveuzqjicfdsinhpicia\">...</div>"
          },
          {
            "ruleID": "AAA.1_4_10.C32,C31,C33,C38,SCR34,G206",
            "what": "This element has \"position: fixed\". This may require scrolling in two dimensions, which is considered a failure of this Success Criterion.",
            "ordinalSeverity": 0,
            "tagName": "DIV",
            "id": "wziehoicgkyratljhitjiidxmxjsagxhbsyb",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-uyuor\" id=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-brz-popup=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-click_outside_to_close=\"true\" data-custom-id=\"ikypnpgzhasdbsxyczhyhiktepvcivqziwaf\">...</div>"
          },
          {
            "ruleID": "AAA.1_4_10.C32,C31,C33,C38,SCR34,G206",
            "what": "This element has \"position: fixed\". This may require scrolling in two dimensions, which is considered a failure of this Success Criterion.",
            "ordinalSeverity": 0,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<div class=\"brz-mm-wrapper__blocker brz-mm-slideout\">...</div>"
          },
          {
            "ruleID": "AAA.1_4_3_F24.F24.FGColour",
            "what": "Check that this element has an inherited background colour or image to complement the corresponding inline foreground colour.",
            "ordinalSeverity": 0,
            "tagName": "STRONG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">...</strong>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-cbllz\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yemcvnewgngfymiotxewwyjzajhaeldnceah\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdggtybzbtscl\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurwjvjsywyumae\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufznyxypipympv\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
          },
          {
            "ruleID": "AAA.3_2_5.H83.3",
            "what": "Check that this link's link text contains information indicating that the link will open in a new window.",
            "ordinalSeverity": 0,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
          },
          {
            "ruleID": "AAA.1_1_1.H37",
            "what": "Img element missing an alt attribute. Use the alt attribute to specify a short text alternative.",
            "ordinalSeverity": 3,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<img src=\"http://ib.adnxs.com/seg?add=30067132&amp;t=2\" width=\"1\" height=\"1\">"
          },
          {
            "ruleID": "AAA.1_3_1.F68",
            "what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.1_3_1.F68",
            "what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.1_3_1.F68",
            "what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.1_3_1.F68",
            "what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.1_3_1.F68",
            "what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.1_3_1.F68",
            "what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.1_3_1.F68",
            "what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.1_4_6.G17.Fail",
            "what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 1:1. Recommendation:  change text colour to #595959.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<span class=\"brz-cp-color8 brz-pre-population-visible\">...</span>"
          },
          {
            "ruleID": "AAA.1_4_6.G17.Fail",
            "what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 1:1. Recommendation:  change text colour to #595959.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<span class=\"brz-cp-color8\">...</span>"
          },
          {
            "ruleID": "AAA.1_4_6.G17.Fail",
            "what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 4.69:1. Recommendation:  change background to #b40900.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">...</span>"
          },
          {
            "ruleID": "AAA.1_4_6.G18.Fail",
            "what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation:  change text colour to #767676.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<span class=\"brz-cp-color8\">...</span>"
          },
          {
            "ruleID": "AAA.1_4_6.G18.Fail",
            "what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation:  change text colour to #767676.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">...</span>"
          },
          {
            "ruleID": "AAA.1_4_6.G18.Fail",
            "what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation:  change text colour to #767676.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<span class=\"brz-span\">...</span>"
          },
          {
            "ruleID": "AAA.1_4_6.G18.Fail",
            "what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation:  change text colour to #767676.",
            "ordinalSeverity": 3,
            "tagName": "STRONG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<strong class=\"brz-cp-color8\">...</strong>"
          },
          {
            "ruleID": "AAA.1_4_6.G18.Fail",
            "what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation:  change text colour to #767676.",
            "ordinalSeverity": 3,
            "tagName": "STRONG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">...</strong>"
          },
          {
            "ruleID": "AAA.2_4_1.G1,G123,G124.NoSuchID",
            "what": "This link points to a named anchor \"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" within the document, but no anchor exists with that name.",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\">...</a>"
          },
          {
            "ruleID": "AAA.2_4_8.H59.1",
            "what": "Link elements can only be located in the head section of the document.",
            "ordinalSeverity": 3,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<link class=\"brz-link brz-link-google-preconnect\" rel=\"preconnect\" href=\"https://fonts.gstatic.com/\" crossorigin=\"\">"
          },
          {
            "ruleID": "AAA.2_4_8.H59.1",
            "what": "Link elements can only be located in the head section of the document.",
            "ordinalSeverity": 3,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//ajax.googleapis.com\">"
          },
          {
            "ruleID": "AAA.2_4_8.H59.1",
            "what": "Link elements can only be located in the head section of the document.",
            "ordinalSeverity": 3,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">"
          },
          {
            "ruleID": "AAA.2_4_8.H59.1",
            "what": "Link elements can only be located in the head section of the document.",
            "ordinalSeverity": 3,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\">"
          },
          {
            "ruleID": "AAA.2_4_8.H59.1",
            "what": "Link elements can only be located in the head section of the document.",
            "ordinalSeverity": 3,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\">"
          },
          {
            "ruleID": "AAA.2_4_8.H59.1",
            "what": "Link elements can only be located in the head section of the document.",
            "ordinalSeverity": 3,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\">"
          },
          {
            "ruleID": "AAA.4_1_1.F77",
            "what": "Duplicate id attribute value \"close-popup\" found on the web page.",
            "ordinalSeverity": 3,
            "tagName": "G",
            "id": "close-popup",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">...</g>"
          },
          {
            "ruleID": "AAA.4_1_1.F77",
            "what": "Duplicate id attribute value \"Line-2\" found on the web page.",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \">...</path>"
          },
          {
            "ruleID": "AAA.4_1_1.F77",
            "what": "Duplicate id attribute value \"Line-2\" found on the web page.",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\">...</path>"
          },
          {
            "ruleID": "AAA.4_1_2.H91.A.NoContent",
            "what": "Anchor element found with a valid href attribute, but no link content has been supplied.",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\">...</a>"
          },
          {
            "ruleID": "AAA.4_1_2.H91.A.NoContent",
            "what": "Anchor element found with a valid href attribute, but no link content has been supplied.",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
          },
          {
            "ruleID": "AAA.4_1_2.H91.A.NoContent",
            "what": "Anchor element found with a valid href attribute, but no link content has been supplied.",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
          },
          {
            "ruleID": "AAA.4_1_2.H91.InputEmail.Name",
            "what": "This emailinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)"
          },
          {
            "ruleID": "AAA.4_1_2.H91.InputEmail.Name",
            "what": "This emailinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)"
          },
          {
            "ruleID": "AAA.4_1_2.H91.InputEmail.Name",
            "what": "This emailinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)"
          },
          {
            "ruleID": "AAA.4_1_2.H91.InputText.Name",
            "what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.4_1_2.H91.InputText.Name",
            "what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.4_1_2.H91.InputText.Name",
            "what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.4_1_2.H91.InputText.Name",
            "what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.4_1_2.H91.InputText.Name",
            "what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.4_1_2.H91.InputText.Name",
            "what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "AAA.4_1_2.H91.InputText.Name",
            "what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
            "ordinalSeverity": 3,
            "tagName": "INPUT",
            "id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
            "location": {
              "doc": "dom",
              "type": "",
              "spec": ""
            },
            "excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          }
        ]
      },
      "endTime": 1687099517666
    },
    {
      "type": "launch",
      "which": "chromium",
      "startTime": 1687099517666,
      "endTime": 1687099518280
    },
    {
      "type": "url",
      "which": "https://joepatterson.com/",
      "what": "Candidate Joe Patterson (R)",
      "startTime": 1687099518280,
      "result": {
        "url": "https://joepatterson.com/"
      },
      "endTime": 1687099519417
    },
    {
      "type": "test",
      "which": "ibm",
      "withItems": true,
      "withNewContent": false,
      "startTime": 1687099519417,
      "url": "https://joepatterson.com/",
      "what": "IBM Accessibility Checker",
      "result": {
        "totals": {
          "violation": 43,
          "recommendation": 5,
          "ignored": 0
        },
        "items": [
          {
            "ruleId": "img_alt_valid",
            "path": {
              "dom": "/html[1]/body[1]/img[1]",
              "aria": "/document[1]/img[1]"
            },
            "message": "The image has neither an alt atttribute nor an ARIA label or title",
            "bounds": {
              "left": 0,
              "top": 14,
              "height": 1,
              "width": 1
            },
            "snippet": "<img height=\"1\" width=\"1\" src=\"http://ib.adnxs.com/seg?add=30067132&t=2\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/link[14]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 328,
              "top": 1915,
              "height": 54,
              "width": 146
            },
            "snippet": "<a data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\" id=\"\" data-brz-link-type=\"external\" href=\"/about/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]",
              "aria": "/document[1]/link[13]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 580,
              "top": 765,
              "height": 54,
              "width": 113
            },
            "snippet": "<a data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]",
              "aria": "/document[1]/link[12]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 484,
              "top": 765,
              "height": 54,
              "width": 86
            },
            "snippet": "<a data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]",
              "aria": "/document[1]/link[11]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 386,
              "top": 765,
              "height": 54,
              "width": 88
            },
            "snippet": "<a data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]",
              "aria": "/document[1]/link[10]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 289,
              "top": 765,
              "height": 54,
              "width": 88
            },
            "snippet": "<a data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]",
              "aria": "/document[1]/link[9]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 195,
              "top": 765,
              "height": 54,
              "width": 85
            },
            "snippet": "<a data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/link[8]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 108,
              "top": 765,
              "height": 54,
              "width": 77
            },
            "snippet": "<a data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[3]/div[1]/div[1]/div[1]/div[1]/div[1]",
              "aria": "/document[1]"
            },
            "message": "The <div> element has the id \"\" that is empty",
            "bounds": {
              "left": 742,
              "top": 225,
              "height": 48,
              "width": 48
            },
            "snippet": "<div data-custom-id=\"muserakcqcfkwarzkttrfzizvtktwtqbysti\" class=\"brz-icon__container\" id=\"\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]",
              "aria": "/document[1]"
            },
            "message": "The <div> element has the id \"\" that is empty",
            "bounds": {
              "left": 11,
              "top": 225,
              "height": 48,
              "width": 48
            },
            "snippet": "<div data-custom-id=\"axlyrxgtqqbwisbspsmpehfdbsksrzxgfgii\" class=\"brz-icon__container\" id=\"\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/link[3]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 498,
              "top": 84,
              "height": 54,
              "width": 150
            },
            "snippet": "<a data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/link[2]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 459,
              "top": 86,
              "height": 48,
              "width": 48
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"popup\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" class=\"brz-a\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]",
              "aria": "/document[1]"
            },
            "message": "The <div> element has the id \"\" that is empty",
            "bounds": {
              "left": 459,
              "top": 86,
              "height": 48,
              "width": 48
            },
            "snippet": "<div data-custom-id=\"pceqxnmehonwogvnkufwatiazpvvrypiilwr\" class=\"brz-icon__container\" id=\"\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/link[1]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 42,
              "top": 56,
              "height": 109,
              "width": 284
            },
            "snippet": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
              "aria": "/document[1]/contentinfo[1]/link[2]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 414,
              "top": 2629,
              "height": 19,
              "width": 32
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]",
              "aria": "/document[1]/contentinfo[1]"
            },
            "message": "The <div> element has the id \"\" that is empty",
            "bounds": {
              "left": 414,
              "top": 2625,
              "height": 32,
              "width": 32
            },
            "snippet": "<div data-custom-id=\"nzkalizvyqxpxwhmghgfojzckegcabnhnsiw\" class=\"brz-icon__container\" id=\"\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/contentinfo[1]/link[1]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 354,
              "top": 2629,
              "height": 19,
              "width": 32
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]",
              "aria": "/document[1]/contentinfo[1]"
            },
            "message": "The <div> element has the id \"\" that is empty",
            "bounds": {
              "left": 354,
              "top": 2625,
              "height": 32,
              "width": 32
            },
            "snippet": "<div data-custom-id=\"gucekfcwzkwvwbcfqjgrflyvigkonlxuvqdd\" class=\"brz-icon__container\" id=\"\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]",
              "aria": "/document[1]/contentinfo[1]/navigation[1]/list[1]/listitem[5]/link[1]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 509,
              "top": 2499,
              "height": 28,
              "width": 60
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]",
              "aria": "/document[1]/contentinfo[1]/navigation[1]/list[1]/listitem[4]/link[1]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 454,
              "top": 2499,
              "height": 28,
              "width": 45
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/ad5/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]",
              "aria": "/document[1]/contentinfo[1]/navigation[1]/list[1]/listitem[3]/link[1]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 392,
              "top": 2499,
              "height": 28,
              "width": 53
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/news/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]",
              "aria": "/document[1]/contentinfo[1]/navigation[1]/list[1]/listitem[2]/link[1]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 299,
              "top": 2499,
              "height": 28,
              "width": 83
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/about/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">",
            "level": "violation"
          },
          {
            "ruleId": "element_id_unique",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]",
              "aria": "/document[1]/contentinfo[1]/navigation[1]/list[1]/listitem[1]/link[1]"
            },
            "message": "The <a> element has the id \"\" that is empty",
            "bounds": {
              "left": 233,
              "top": 2499,
              "height": 28,
              "width": 57
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
              "aria": "/document[1]/paragraph[13]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 30,
              "top": 2098,
              "height": 84,
              "width": 740
            },
            "snippet": "<p data-generated-css=\"brz-css-owucl\" data-uniq-id=\"qxpfh\" class=\"brz-css-bklfk\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/link[14]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 328,
              "top": 1915,
              "height": 54,
              "width": 146
            },
            "snippet": "<a data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\" id=\"\" data-brz-link-type=\"external\" href=\"/about/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]",
              "aria": "/document[1]/paragraph[12]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 30,
              "top": 1775,
              "height": 120,
              "width": 740
            },
            "snippet": "<p data-generated-css=\"brz-css-eyoug\" data-uniq-id=\"mdupv\" class=\"brz-css-bnogt\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
              "aria": "/document[1]/paragraph[11]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 30,
              "top": 1683,
              "height": 73,
              "width": 740
            },
            "snippet": "<p data-uniq-id=\"ssqmz\" data-generated-css=\"brz-css-fyurj\" class=\"brz-css-nhelt\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[1]/div[1]/div[1]/p[1]",
              "aria": "/document[1]/paragraph[10]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 52,
              "top": 1343,
              "height": 46,
              "width": 696
            },
            "snippet": "<p class=\"brz-css-dbkfe\" data-generated-css=\"brz-css-owosm\" data-uniq-id=\"hwwdz\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]",
              "aria": "/document[1]/link[13]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 580,
              "top": 765,
              "height": 54,
              "width": 113
            },
            "snippet": "<a data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]",
              "aria": "/document[1]/link[12]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 484,
              "top": 765,
              "height": 54,
              "width": 86
            },
            "snippet": "<a data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]",
              "aria": "/document[1]/link[11]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 386,
              "top": 765,
              "height": 54,
              "width": 88
            },
            "snippet": "<a data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]",
              "aria": "/document[1]/link[10]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 289,
              "top": 765,
              "height": 54,
              "width": 88
            },
            "snippet": "<a data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]",
              "aria": "/document[1]/link[9]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 195,
              "top": 765,
              "height": 54,
              "width": 85
            },
            "snippet": "<a data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/link[8]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 108,
              "top": 765,
              "height": 54,
              "width": 77
            },
            "snippet": "<a data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[3]/div[1]/div[1]/p[1]",
              "aria": "/document[1]/paragraph[8]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 15,
              "top": 647,
              "height": 58,
              "width": 770
            },
            "snippet": "<p data-generated-css=\"brz-css-erjeq\" data-uniq-id=\"lwuac\" class=\"brz-css-mkkan\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[2]/div[1]/div[1]/p[1]",
              "aria": "/document[1]/paragraph[7]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 15,
              "top": 560,
              "height": 110,
              "width": 770
            },
            "snippet": "<p data-uniq-id=\"hpxfi\" data-generated-css=\"brz-css-kokqw\" class=\"brz-css-lkuyo\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]",
              "aria": "/document[1]/paragraph[5]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 102,
              "top": 355,
              "height": 141,
              "width": 598
            },
            "snippet": "<p data-uniq-id=\"nwtym\" data-generated-css=\"brz-css-armam\" class=\"brz-css-aesxw\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
              "aria": "/document[1]/paragraph[3]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 102,
              "top": 230,
              "height": 60,
              "width": 598
            },
            "snippet": "<p data-generated-css=\"brz-css-iqboz\" data-uniq-id=\"acvfi\" class=\"brz-css-mntwc\">",
            "level": "violation"
          },
          {
            "ruleId": "aria_content_in_landmark",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/link[3]"
            },
            "message": "Content is not within a landmark element",
            "bounds": {
              "left": 498,
              "top": 84,
              "height": 54,
              "width": 150
            },
            "snippet": "<a data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\">",
            "level": "violation"
          },
          {
            "ruleId": "a_text_purpose",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/link[2]"
            },
            "message": "Hyperlink has no link text, label or image with a text alternative",
            "bounds": {
              "left": 459,
              "top": 86,
              "height": 48,
              "width": 48
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"popup\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" class=\"brz-a\">",
            "level": "violation"
          },
          {
            "ruleId": "a_text_purpose",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/link[1]"
            },
            "message": "Hyperlink has no link text, label or image with a text alternative",
            "bounds": {
              "left": 42,
              "top": 56,
              "height": 109,
              "width": 284
            },
            "snippet": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\">",
            "level": "violation"
          },
          {
            "ruleId": "a_text_purpose",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
              "aria": "/document[1]/contentinfo[1]/link[2]"
            },
            "message": "Hyperlink has no link text, label or image with a text alternative",
            "bounds": {
              "left": 414,
              "top": 2629,
              "height": 19,
              "width": 32
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\">",
            "level": "violation"
          },
          {
            "ruleId": "a_text_purpose",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
              "aria": "/document[1]/contentinfo[1]/link[1]"
            },
            "message": "Hyperlink has no link text, label or image with a text alternative",
            "bounds": {
              "left": 354,
              "top": 2629,
              "height": 19,
              "width": 32
            },
            "snippet": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\">",
            "level": "violation"
          },
          {
            "ruleId": "element_attribute_deprecated",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]/svg[1]",
              "aria": "/document[1]/link[3]/graphics-document[1]"
            },
            "message": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
            "bounds": {
              "left": 603,
              "top": 102,
              "height": 16,
              "width": 16
            },
            "snippet": "<svg data-name=\"tail-right\" data-type=\"glyph\" class=\"brz-icon-svg brz-css-oheuj\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">",
            "level": "recommendation"
          },
          {
            "ruleId": "element_attribute_deprecated",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]/span[1]/svg[1]",
              "aria": "/document[1]/link[2]/graphics-document[1]"
            },
            "message": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
            "bounds": {
              "left": 459,
              "top": 86,
              "height": 48,
              "width": 48
            },
            "snippet": "<svg data-name=\"menu-34\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">",
            "level": "recommendation"
          },
          {
            "ruleId": "element_attribute_deprecated",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]/span[1]/svg[1]",
              "aria": "/document[1]/contentinfo[1]/link[2]/graphics-document[1]"
            },
            "message": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
            "bounds": {
              "left": 414,
              "top": 2625,
              "height": 32,
              "width": 32
            },
            "snippet": "<svg data-name=\"logo-twitter\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">",
            "level": "recommendation"
          },
          {
            "ruleId": "element_attribute_deprecated",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]/span[1]/svg[1]",
              "aria": "/document[1]/contentinfo[1]/link[1]/graphics-document[1]"
            },
            "message": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
            "bounds": {
              "left": 354,
              "top": 2625,
              "height": 32,
              "width": 32
            },
            "snippet": "<svg data-name=\"logo-facebook\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">",
            "level": "recommendation"
          },
          {
            "ruleId": "aria_contentinfo_misuse",
            "path": {
              "dom": "/html[1]/body[1]/div[1]/footer[1]",
              "aria": "/document[1]/contentinfo[1]"
            },
            "message": "The element with \"contentinfo\" role is present without an element with \"main\" role",
            "bounds": {
              "left": 0,
              "top": 2452,
              "height": 464,
              "width": 800
            },
            "snippet": "<footer data-custom-id=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\" class=\"brz-footer brz-css-amejp brz-css-sstgn\" id=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\" data-uid=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\">",
            "level": "recommendation"
          }
        ],
        "success": true
      },
      "standardResult": {
        "totals": [
          0,
          5,
          0,
          43
        ],
        "instances": [
          {
            "ruleID": "img_alt_valid",
            "what": "The image has neither an alt atttribute nor an ARIA label or title",
            "ordinalSeverity": 3,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/img[1]"
            },
            "excerpt": "<img height=\"1\" width=\"1\" src=\"http://ib.adnxs.com/seg?add=30067132&t=2\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\" id=\"\" data-brz-link-type=\"external\" href=\"/about/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <div> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[3]/div[1]/div[1]/div[1]/div[1]/div[1]"
            },
            "excerpt": "<div data-custom-id=\"muserakcqcfkwarzkttrfzizvtktwtqbysti\" class=\"brz-icon__container\" id=\"\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <div> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]"
            },
            "excerpt": "<div data-custom-id=\"axlyrxgtqqbwisbspsmpehfdbsksrzxgfgii\" class=\"brz-icon__container\" id=\"\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"popup\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" class=\"brz-a\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <div> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]"
            },
            "excerpt": "<div data-custom-id=\"pceqxnmehonwogvnkufwatiazpvvrypiilwr\" class=\"brz-icon__container\" id=\"\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <div> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]"
            },
            "excerpt": "<div data-custom-id=\"nzkalizvyqxpxwhmghgfojzckegcabnhnsiw\" class=\"brz-icon__container\" id=\"\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <div> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]"
            },
            "excerpt": "<div data-custom-id=\"gucekfcwzkwvwbcfqjgrflyvigkonlxuvqdd\" class=\"brz-icon__container\" id=\"\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/ad5/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/news/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/about/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">"
          },
          {
            "ruleID": "element_id_unique",
            "what": "The <a> element has the id \"\" that is empty",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p data-generated-css=\"brz-css-owucl\" data-uniq-id=\"qxpfh\" class=\"brz-css-bklfk\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\" id=\"\" data-brz-link-type=\"external\" href=\"/about/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p data-generated-css=\"brz-css-eyoug\" data-uniq-id=\"mdupv\" class=\"brz-css-bnogt\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p data-uniq-id=\"ssqmz\" data-generated-css=\"brz-css-fyurj\" class=\"brz-css-nhelt\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[1]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p class=\"brz-css-dbkfe\" data-generated-css=\"brz-css-owosm\" data-uniq-id=\"hwwdz\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[3]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p data-generated-css=\"brz-css-erjeq\" data-uniq-id=\"lwuac\" class=\"brz-css-mkkan\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[2]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p data-uniq-id=\"hpxfi\" data-generated-css=\"brz-css-kokqw\" class=\"brz-css-lkuyo\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]"
            },
            "excerpt": "<p data-uniq-id=\"nwtym\" data-generated-css=\"brz-css-armam\" class=\"brz-css-aesxw\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
            },
            "excerpt": "<p data-generated-css=\"brz-css-iqboz\" data-uniq-id=\"acvfi\" class=\"brz-css-mntwc\">"
          },
          {
            "ruleID": "aria_content_in_landmark",
            "what": "Content is not within a landmark element",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\">"
          },
          {
            "ruleID": "a_text_purpose",
            "what": "Hyperlink has no link text, label or image with a text alternative",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"popup\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" class=\"brz-a\">"
          },
          {
            "ruleID": "a_text_purpose",
            "what": "Hyperlink has no link text, label or image with a text alternative",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\">"
          },
          {
            "ruleID": "a_text_purpose",
            "what": "Hyperlink has no link text, label or image with a text alternative",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\">"
          },
          {
            "ruleID": "a_text_purpose",
            "what": "Hyperlink has no link text, label or image with a text alternative",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
            },
            "excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\">"
          },
          {
            "ruleID": "element_attribute_deprecated",
            "what": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
            "ordinalSeverity": 1,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]/svg[1]"
            },
            "excerpt": "<svg data-name=\"tail-right\" data-type=\"glyph\" class=\"brz-icon-svg brz-css-oheuj\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">"
          },
          {
            "ruleID": "element_attribute_deprecated",
            "what": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
            "ordinalSeverity": 1,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]/span[1]/svg[1]"
            },
            "excerpt": "<svg data-name=\"menu-34\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">"
          },
          {
            "ruleID": "element_attribute_deprecated",
            "what": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
            "ordinalSeverity": 1,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]/span[1]/svg[1]"
            },
            "excerpt": "<svg data-name=\"logo-twitter\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">"
          },
          {
            "ruleID": "element_attribute_deprecated",
            "what": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
            "ordinalSeverity": 1,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]/span[1]/svg[1]"
            },
            "excerpt": "<svg data-name=\"logo-facebook\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">"
          },
          {
            "ruleID": "aria_contentinfo_misuse",
            "what": "The element with \"contentinfo\" role is present without an element with \"main\" role",
            "ordinalSeverity": 1,
            "tagName": "FOOTER",
            "id": "ekgwjnuvotyydehtoshkvsgqrplvompyerpl",
            "location": {
              "doc": "dom",
              "type": "xpath",
              "spec": "/html[1]/body[1]/div[1]/footer[1]"
            },
            "excerpt": "<footer data-custom-id=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\" class=\"brz-footer brz-css-amejp brz-css-sstgn\" id=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\" data-uid=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\">"
          }
        ]
      },
      "endTime": 1687099522771
    },
    {
      "type": "launch",
      "which": "chromium",
      "startTime": 1687099522771,
      "endTime": 1687099523406
    },
    {
      "type": "url",
      "which": "https://joepatterson.com/",
      "what": "Candidate Joe Patterson (R)",
      "startTime": 1687099523407,
      "result": {
        "url": "https://joepatterson.com/"
      },
      "endTime": 1687099524794
    },
    {
      "type": "test",
      "which": "nuVal",
      "startTime": 1687099524794,
      "url": "https://joepatterson.com/",
      "what": "Nu Html Checker",
      "result": {
        "pageContent": {
          "messages": [
            {
              "type": "error",
              "lastLine": 110,
              "firstLine": 108,
              "lastColumn": 2,
              "firstColumn": 11,
              "message": "Bad start tag in img in noscript in head.",
              "extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
              "hiliteStart": 10,
              "hiliteLength": 126
            },
            {
              "type": "error",
              "lastLine": 110,
              "firstLine": 108,
              "lastColumn": 2,
              "firstColumn": 11,
              "message": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
              "extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
              "hiliteStart": 10,
              "hiliteLength": 126
            },
            {
              "type": "info",
              "lastLine": 110,
              "firstLine": 108,
              "lastColumn": 2,
              "firstColumn": 11,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
              "hiliteStart": 10,
              "hiliteLength": 126
            },
            {
              "type": "error",
              "lastLine": 110,
              "lastColumn": 13,
              "firstColumn": 3,
              "message": "Stray end tag noscript.",
              "extract": "ript=1\"\n/></noscript>\n<!-- ",
              "hiliteStart": 10,
              "hiliteLength": 11
            },
            {
              "type": "info",
              "lastLine": 113,
              "lastColumn": 167,
              "firstColumn": 81,
              "subType": "warning",
              "message": "The type attribute is unnecessary for JavaScript resources.",
              "extract": "MODIFY --><script src=\"https://secure.adnxs.com/seg?add=30067132&amp;t=1\" type=\"text/javascript\"></scri",
              "hiliteStart": 10,
              "hiliteLength": 87
            },
            {
              "type": "error",
              "lastLine": 115,
              "lastColumn": 145,
              "firstColumn": 139,
              "message": "Stray end tag head.",
              "extract": "></script></head><body ",
              "hiliteStart": 10,
              "hiliteLength": 7
            },
            {
              "type": "error",
              "lastLine": 115,
              "lastColumn": 461,
              "firstColumn": 146,
              "message": "Start tag body seen but an element of the same type was already open.",
              "extract": "pt></head><body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz brz-mm-wrapper\" style=\"\"><img s",
              "hiliteStart": 10,
              "hiliteLength": 316
            },
            {
              "type": "error",
              "lastLine": 115,
              "lastColumn": 461,
              "firstColumn": 146,
              "subType": "fatal",
              "message": "Cannot recover after last error. Any further errors will be ignored.",
              "extract": "pt></head><body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz brz-mm-wrapper\" style=\"\"><img s",
              "hiliteStart": 10,
              "hiliteLength": 316
            }
          ]
        },
        "rawPage": {
          "messages": [
            {
              "type": "info",
              "lastLine": 11,
              "lastColumn": 66,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "2.0 -->\n\t\t<meta name=\"description\" content=\"Joe Patterson for Assembly\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 64
            },
            {
              "type": "info",
              "lastLine": 12,
              "lastColumn": 58,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "bly\" />\n\t\t<meta name=\"robots\" content=\"max-image-preview:large\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 56
            },
            {
              "type": "info",
              "lastLine": 13,
              "lastColumn": 121,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "rge\" />\n\t\t<meta name=\"google-site-verification\" content=\"google-site-verification=gQYW2QR6cad9zs_bhpn9WTkMktiJqpHCGlGIqG5akk4\" />\n\t\t<li",
              "hiliteStart": 10,
              "hiliteLength": 119
            },
            {
              "type": "info",
              "lastLine": 14,
              "lastColumn": 59,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "kk4\" />\n\t\t<link rel=\"canonical\" href=\"https://joepatterson.com/\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 57
            },
            {
              "type": "info",
              "lastLine": 15,
              "lastColumn": 47,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "om/\" />\n\t\t<meta property=\"og:locale\" content=\"en_US\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 45
            },
            {
              "type": "info",
              "lastLine": 16,
              "lastColumn": 60,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "_US\" />\n\t\t<meta property=\"og:site_name\" content=\"Joe Patterson -\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 58
            },
            {
              "type": "info",
              "lastLine": 17,
              "lastColumn": 47,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "n -\" />\n\t\t<meta property=\"og:type\" content=\"website\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 45
            },
            {
              "type": "info",
              "lastLine": 18,
              "lastColumn": 54,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "ite\" />\n\t\t<meta property=\"og:title\" content=\"Joe Patterson\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 52
            },
            {
              "type": "info",
              "lastLine": 19,
              "lastColumn": 73,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "son\" />\n\t\t<meta property=\"og:description\" content=\"Joe Patterson for Assembly\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 71
            },
            {
              "type": "info",
              "lastLine": 20,
              "lastColumn": 64,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "bly\" />\n\t\t<meta property=\"og:url\" content=\"https://joepatterson.com/\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 62
            },
            {
              "type": "info",
              "lastLine": 21,
              "lastColumn": 161,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "om/\" />\n\t\t<meta property=\"og:image\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 159
            },
            {
              "type": "info",
              "lastLine": 22,
              "lastColumn": 172,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "jpg\" />\n\t\t<meta property=\"og:image:secure_url\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 170
            },
            {
              "type": "info",
              "lastLine": 23,
              "lastColumn": 51,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "jpg\" />\n\t\t<meta property=\"og:image:width\" content=\"2048\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 49
            },
            {
              "type": "info",
              "lastLine": 24,
              "lastColumn": 52,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "048\" />\n\t\t<meta property=\"og:image:height\" content=\"1365\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 50
            },
            {
              "type": "info",
              "lastLine": 25,
              "lastColumn": 48,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "365\" />\n\t\t<meta name=\"twitter:card\" content=\"summary\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 46
            },
            {
              "type": "info",
              "lastLine": 26,
              "lastColumn": 52,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "ary\" />\n\t\t<meta name=\"twitter:site\" content=\"@Patterdude\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 50
            },
            {
              "type": "info",
              "lastLine": 27,
              "lastColumn": 55,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "ude\" />\n\t\t<meta name=\"twitter:title\" content=\"Joe Patterson\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 53
            },
            {
              "type": "info",
              "lastLine": 28,
              "lastColumn": 74,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "son\" />\n\t\t<meta name=\"twitter:description\" content=\"Joe Patterson for Assembly\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 72
            },
            {
              "type": "info",
              "lastLine": 29,
              "lastColumn": 55,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "bly\" />\n\t\t<meta name=\"twitter:creator\" content=\"@Patterdude\" />\n\t\t<me",
              "hiliteStart": 10,
              "hiliteLength": 53
            },
            {
              "type": "info",
              "lastLine": 30,
              "lastColumn": 162,
              "firstColumn": 3,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "ude\" />\n\t\t<meta name=\"twitter:image\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" />\n\t\t<sc",
              "hiliteStart": 10,
              "hiliteLength": 160
            },
            {
              "type": "info",
              "lastLine": 36,
              "lastColumn": 57,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": " SEO -->\n\n<link rel='dns-prefetch' href='//fonts.googleapis.com' />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 57
            },
            {
              "type": "info",
              "lastLine": 37,
              "lastColumn": 124,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "s.com' />\n<link rel=\"alternate\" type=\"application/rss+xml\" title=\"Joe Patterson &raquo; Feed\" href=\"https://joepatterson.com/feed/\" />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 124
            },
            {
              "type": "info",
              "lastLine": 38,
              "lastColumn": 142,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "feed/\" />\n<link rel=\"alternate\" type=\"application/rss+xml\" title=\"Joe Patterson &raquo; Comments Feed\" href=\"https://joepatterson.com/comments/feed/\" />\n\t\t<!-",
              "hiliteStart": 10,
              "hiliteLength": 142
            },
            {
              "type": "info",
              "lastLine": 62,
              "lastColumn": 163,
              "firstColumn": 2,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "</style>\n\t<link rel='stylesheet' id='astra-theme-css-css' href='https://joepatterson.com/wp-content/themes/astra/assets/css/minified/main.min.css?ver=3.7.10' media='all' />\n<styl",
              "hiliteStart": 10,
              "hiliteLength": 162
            },
            {
              "type": "info",
              "lastLine": 66,
              "lastColumn": 154,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "\n</style>\n<link rel='stylesheet' id='wp-block-library-css' href='https://joepatterson.com/wp-includes/css/dist/block-library/style.min.css?ver=6.2.2' media='all' />\n<styl",
              "hiliteStart": 10,
              "hiliteLength": 154
            },
            {
              "type": "info",
              "lastLine": 73,
              "lastColumn": 871,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "\n</style>\n<link rel='stylesheet' id='brizy-asset-google-10-css'  class=\"brz-link brz-link-google\" type=\"text/css\" href='https://fonts.googleapis.com/css?family=Overpass%3A100%2C100italic%2C200%2C200italic%2C300%2C300italic%2Cregular%2Citalic%2C600%2C600italic%2C700%2C700italic%2C800%2C800italic%2C900%2C900italic%7CMontserrat%3A100%2C100italic%2C200%2C200italic%2C300%2C300italic%2Cregular%2Citalic%2C500%2C500italic%2C600%2C600italic%2C700%2C700italic%2C800%2C800italic%2C900%2C900italic%7CLato%3A100%2C100italic%2C300%2C300italic%2Cregular%2Citalic%2C700%2C700italic%2C900%2C900italic%7CRed+Hat+Text%3Aregular%2Citalic%2C500%2C500italic%2C700%2C700italic&#038;subset=arabic%2Cbengali%2Ccyrillic%2Ccyrillic-ext%2Cdevanagari%2Cgreek%2Cgreek-ext%2Cgujarati%2Chebrew%2Ckhmer%2Ckorean%2Clatin-ext%2Ctamil%2Ctelugu%2Cthai%2Cvietnamese&#038;display=swap&#038;ver=2.3.35' media='all' />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 871
            },
            {
              "type": "info",
              "lastLine": 74,
              "lastColumn": 247,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "='all' />\n<link rel='stylesheet' id='brizy-asset-group-1-20-css'  class=\"brz-link brz-link-preview-lib\" data-group=\"group-1\" href='https://joepatterson.com/wp-content/plugins/brizy/public/editor-build/232-wp/editor/css/group-1.css?ver=2.3.35' media='all' />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 247
            },
            {
              "type": "info",
              "lastLine": 75,
              "lastColumn": 252,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "='all' />\n<link rel='stylesheet' id='brizy-asset-group-2-21-css'  class=\"brz-link brz-link-preview-lib-pro\" data-group=\"group-2\" href='https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/group-2-pro.css?ver=2.3.28' media='all' />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 252
            },
            {
              "type": "info",
              "lastLine": 76,
              "lastColumn": 224,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "='all' />\n<link rel='stylesheet' id='brizy-asset-main-30-css'  class=\"brz-link brz-link-preview-pro\" href='https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/preview.pro.css?ver=2.3.28' media='all' />\n<styl",
              "hiliteStart": 10,
              "hiliteLength": 224
            },
            {
              "type": "info",
              "lastLine": 91,
              "lastColumn": 74,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "</script>\n<link rel=\"https://api.w.org/\" href=\"https://joepatterson.com/wp-json/\" /><link ",
              "hiliteStart": 10,
              "hiliteLength": 74
            },
            {
              "type": "info",
              "lastLine": 91,
              "lastColumn": 177,
              "firstColumn": 75,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "-json/\" /><link rel=\"alternate\" type=\"application/json\" href=\"https://joepatterson.com/wp-json/wp/v2/pages/16\" /><link ",
              "hiliteStart": 10,
              "hiliteLength": 103
            },
            {
              "type": "info",
              "lastLine": 91,
              "lastColumn": 285,
              "firstColumn": 178,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "ges/16\" /><link rel=\"EditURI\" type=\"application/rsd+xml\" title=\"RSD\" href=\"https://joepatterson.com/xmlrpc.php?rsd\" />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 108
            },
            {
              "type": "info",
              "lastLine": 92,
              "lastColumn": 121,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "p?rsd\" />\n<link rel=\"wlwmanifest\" type=\"application/wlwmanifest+xml\" href=\"https://joepatterson.com/wp-includes/wlwmanifest.xml\" />\n<meta",
              "hiliteStart": 10,
              "hiliteLength": 121
            },
            {
              "type": "info",
              "lastLine": 93,
              "lastColumn": 51,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "t.xml\" />\n<meta name=\"generator\" content=\"WordPress 6.2.2\" />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 51
            },
            {
              "type": "info",
              "lastLine": 94,
              "lastColumn": 57,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "6.2.2\" />\n<link rel='shortlink' href='https://joepatterson.com/' />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 57
            },
            {
              "type": "info",
              "lastLine": 95,
              "lastColumn": 150,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": ".com/' />\n<link rel=\"alternate\" type=\"application/json+oembed\" href=\"https://joepatterson.com/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fjoepatterson.com%2F\" />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 150
            },
            {
              "type": "info",
              "lastLine": 96,
              "lastColumn": 158,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "om%2F\" />\n<link rel=\"alternate\" type=\"text/xml+oembed\" href=\"https://joepatterson.com/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fjoepatterson.com%2F&#038;format=xml\" />\n<meta",
              "hiliteStart": 10,
              "hiliteLength": 158
            },
            {
              "type": "info",
              "lastLine": 97,
              "lastColumn": 85,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "t=xml\" />\n<meta name=\"facebook-domain-verification\" content=\"1tt0ezdlks2lf51jfn2nqzm3lnirj0\" />\n<!-- ",
              "hiliteStart": 10,
              "hiliteLength": 85
            },
            {
              "type": "error",
              "lastLine": 113,
              "firstLine": 111,
              "lastColumn": 2,
              "firstColumn": 11,
              "message": "Bad start tag in img in noscript in head.",
              "extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
              "hiliteStart": 10,
              "hiliteLength": 126
            },
            {
              "type": "error",
              "lastLine": 113,
              "firstLine": 111,
              "lastColumn": 2,
              "firstColumn": 11,
              "message": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
              "extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
              "hiliteStart": 10,
              "hiliteLength": 126
            },
            {
              "type": "info",
              "lastLine": 113,
              "firstLine": 111,
              "lastColumn": 2,
              "firstColumn": 11,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
              "hiliteStart": 10,
              "hiliteLength": 126
            },
            {
              "type": "error",
              "lastLine": 113,
              "lastColumn": 13,
              "firstColumn": 3,
              "message": "Stray end tag noscript.",
              "extract": "ript=1\"\n/></noscript>\n<!-- ",
              "hiliteStart": 10,
              "hiliteLength": 11
            },
            {
              "type": "info",
              "lastLine": 116,
              "lastColumn": 163,
              "firstColumn": 81,
              "subType": "warning",
              "message": "The type attribute is unnecessary for JavaScript resources.",
              "extract": "MODIFY --><script src='https://secure.adnxs.com/seg?add=30067132&t=1' type='text/javascript'></scri",
              "hiliteStart": 10,
              "hiliteLength": 83
            },
            {
              "type": "error",
              "lastLine": 118,
              "lastColumn": 155,
              "firstColumn": 81,
              "message": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
              "extract": "MODIFY --><img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\" /><!-- E",
              "hiliteStart": 10,
              "hiliteLength": 75
            },
            {
              "type": "info",
              "lastLine": 118,
              "lastColumn": 155,
              "firstColumn": 81,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "MODIFY --><img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\" /><!-- E",
              "hiliteStart": 10,
              "hiliteLength": 75
            },
            {
              "type": "info",
              "lastLine": 120,
              "lastColumn": 31,
              "firstColumn": 1,
              "subType": "warning",
              "message": "The type attribute is unnecessary for JavaScript resources.",
              "extract": " Code -->\n<script type='text/javascript'>\n!func",
              "hiliteStart": 10,
              "hiliteLength": 31
            },
            {
              "type": "info",
              "lastLine": 128,
              "lastColumn": 31,
              "firstColumn": 1,
              "subType": "warning",
              "message": "The type attribute is unnecessary for JavaScript resources.",
              "extract": " Code -->\n<script type='text/javascript'>\n  fbq",
              "hiliteStart": 10,
              "hiliteLength": 31
            },
            {
              "type": "info",
              "lastLine": 132,
              "lastColumn": 40,
              "firstColumn": 10,
              "subType": "warning",
              "message": "The type attribute is unnecessary for JavaScript resources.",
              "extract": "\n</script><script type='text/javascript'>\n  fbq",
              "hiliteStart": 10,
              "hiliteLength": 31
            },
            {
              "type": "info",
              "lastLine": 138,
              "firstLine": 137,
              "lastColumn": 79,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "noscript>\n<img height=\"1\" width=\"1\" style=\"display:none\" alt=\"fbpx\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" />\n</nos",
              "hiliteStart": 10,
              "hiliteLength": 137
            },
            {
              "type": "error",
              "lastLine": 141,
              "lastColumn": 68,
              "firstColumn": 1,
              "message": "Attribute name not allowed on element meta at this point.",
              "extract": " Code -->\n<meta name=\"viewport\" content=\"width=device-width, initial-scale=1\">\n<link",
              "hiliteStart": 10,
              "hiliteLength": 68
            },
            {
              "type": "error",
              "lastLine": 141,
              "lastColumn": 68,
              "firstColumn": 1,
              "message": "Element meta is missing one or more of the following attributes: itemprop, property.",
              "extract": " Code -->\n<meta name=\"viewport\" content=\"width=device-width, initial-scale=1\">\n<link",
              "hiliteStart": 10,
              "hiliteLength": 68
            },
            {
              "type": "error",
              "lastLine": 143,
              "lastColumn": 25,
              "firstColumn": 1,
              "message": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
              "extract": "ssorigin>\n<style class=\"brz-style\">.brz .",
              "hiliteStart": 10,
              "hiliteLength": 25
            },
            {
              "type": "error",
              "lastLine": 143,
              "lastColumn": 5938,
              "firstColumn": 5914,
              "message": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
              "extract": "}}</style><style class=\"brz-style\">@media",
              "hiliteStart": 10,
              "hiliteLength": 25
            },
            {
              "type": "error",
              "lastLine": 154,
              "lastColumn": 4938,
              "message": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
              "extract": "x + 10px + 10px); padding-righ",
              "hiliteStart": 15,
              "hiliteLength": 1
            },
            {
              "type": "error",
              "lastLine": 154,
              "lastColumn": 10896,
              "message": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
              "extract": "x + 10px + 10px); padding-righ",
              "hiliteStart": 15,
              "hiliteLength": 1
            },
            {
              "type": "error",
              "lastLine": 154,
              "lastColumn": 17278,
              "message": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
              "extract": "x + 10px + 10px); padding-righ",
              "hiliteStart": 15,
              "hiliteLength": 1
            },
            {
              "type": "error",
              "lastLine": 204,
              "lastColumn": 4078,
              "message": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
              "extract": "x + 10px + 10px); padding-righ",
              "hiliteStart": 15,
              "hiliteLength": 1
            },
            {
              "type": "error",
              "lastLine": 349,
              "lastColumn": 124,
              "firstColumn": 1,
              "message": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
              "extract": "\n</style>\n<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\" />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 124
            },
            {
              "type": "info",
              "lastLine": 349,
              "lastColumn": 124,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "\n</style>\n<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\" />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 124
            },
            {
              "type": "error",
              "lastLine": 350,
              "lastColumn": 128,
              "firstColumn": 1,
              "message": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
              "extract": "32x32\" />\n<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\" />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 128
            },
            {
              "type": "info",
              "lastLine": 350,
              "lastColumn": 128,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "32x32\" />\n<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\" />\n<link",
              "hiliteStart": 10,
              "hiliteLength": 128
            },
            {
              "type": "error",
              "lastLine": 351,
              "lastColumn": 124,
              "firstColumn": 1,
              "message": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
              "extract": "2x192\" />\n<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\" />\n<meta",
              "hiliteStart": 10,
              "hiliteLength": 124
            },
            {
              "type": "info",
              "lastLine": 351,
              "lastColumn": 124,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "2x192\" />\n<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\" />\n<meta",
              "hiliteStart": 10,
              "hiliteLength": 124
            },
            {
              "type": "error",
              "lastLine": 352,
              "lastColumn": 135,
              "firstColumn": 1,
              "message": "Attribute name not allowed on element meta at this point.",
              "extract": "0.jpg\" />\n<meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" />\n</hea",
              "hiliteStart": 10,
              "hiliteLength": 135
            },
            {
              "type": "error",
              "lastLine": 352,
              "lastColumn": 135,
              "firstColumn": 1,
              "message": "Element meta is missing one or more of the following attributes: itemprop, property.",
              "extract": "0.jpg\" />\n<meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" />\n</hea",
              "hiliteStart": 10,
              "hiliteLength": 135
            },
            {
              "type": "info",
              "lastLine": 352,
              "lastColumn": 135,
              "firstColumn": 1,
              "message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
              "extract": "0.jpg\" />\n<meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" />\n</hea",
              "hiliteStart": 10,
              "hiliteLength": 135
            },
            {
              "type": "error",
              "lastLine": 353,
              "lastColumn": 7,
              "firstColumn": 1,
              "message": "Stray end tag head.",
              "extract": "0.jpg\" />\n</head>\n<body",
              "hiliteStart": 10,
              "hiliteLength": 7
            },
            {
              "type": "error",
              "lastLine": 354,
              "lastColumn": 292,
              "firstColumn": 1,
              "message": "Start tag body seen but an element of the same type was already open.",
              "extract": ">\n</head>\n<body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz\">\n    <",
              "hiliteStart": 10,
              "hiliteLength": 292
            },
            {
              "type": "error",
              "lastLine": 354,
              "lastColumn": 292,
              "firstColumn": 1,
              "subType": "fatal",
              "message": "Cannot recover after last error. Any further errors will be ignored.",
              "extract": ">\n</head>\n<body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz\">\n    <",
              "hiliteStart": 10,
              "hiliteLength": 292
            }
          ]
        },
        "success": true
      },
      "standardResult": {
        "totals": [
          5,
          0,
          24,
          2
        ],
        "instances": [
          {
            "ruleID": "Bad start tag in img in noscript in head.",
            "what": "Bad start tag in img in noscript in head.",
            "ordinalSeverity": 2,
            "tagName": "NOSCRIPT",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "line",
              "spec": "110"
            },
            "excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
          },
          {
            "ruleID": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
            "what": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
            "ordinalSeverity": 2,
            "tagName": "NOSCRIPT",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "line",
              "spec": "110"
            },
            "excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "NOSCRIPT",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "line",
              "spec": "110"
            },
            "excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
          },
          {
            "ruleID": "Stray end tag noscript.",
            "what": "Stray end tag noscript.",
            "ordinalSeverity": 2,
            "tagName": "",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "line",
              "spec": "110"
            },
            "excerpt": "ript=1\" /></noscript> <!-- "
          },
          {
            "ruleID": "The type attribute is unnecessary for JavaScript resources.",
            "what": "The type attribute is unnecessary for JavaScript resources.",
            "ordinalSeverity": 0,
            "tagName": "SCRIPT",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "line",
              "spec": "113"
            },
            "excerpt": "MODIFY --><script src=\"https://secure.adnxs.com/seg?add=30067132&amp;t=1\" type=\"text/javascript\"></scri"
          },
          {
            "ruleID": "Stray end tag head.",
            "what": "Stray end tag head.",
            "ordinalSeverity": 2,
            "tagName": "BODY",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "line",
              "spec": "115"
            },
            "excerpt": "></script></head><body "
          },
          {
            "ruleID": "Start tag body seen but an element of the same type was already open.",
            "what": "Start tag body seen but an element of the same type was already open.",
            "ordinalSeverity": 2,
            "tagName": "BODY",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "line",
              "spec": "115"
            },
            "excerpt": "pt></head><body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz brz-mm-wrapper\" style=\"\"><img s"
          },
          {
            "ruleID": "Cannot recover after last error. Any further errors will be ignored.",
            "what": "Cannot recover after last error. Any further errors will be ignored.",
            "ordinalSeverity": 3,
            "tagName": "BODY",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "line",
              "spec": "115"
            },
            "excerpt": "pt></head><body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz brz-mm-wrapper\" style=\"\"><img s"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "11"
            },
            "excerpt": "2.0 --> <meta name=\"description\" content=\"Joe Patterson for Assembly\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "12"
            },
            "excerpt": "bly\" /> <meta name=\"robots\" content=\"max-image-preview:large\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "13"
            },
            "excerpt": "rge\" /> <meta name=\"google-site-verification\" content=\"google-site-verification=gQYW2QR6cad9zs_bhpn9WTkMktiJqpHCGlGIqG5akk4\" /> <li"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "14"
            },
            "excerpt": "kk4\" /> <link rel=\"canonical\" href=\"https://joepatterson.com/\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "15"
            },
            "excerpt": "om/\" /> <meta property=\"og:locale\" content=\"en_US\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "16"
            },
            "excerpt": "_US\" /> <meta property=\"og:site_name\" content=\"Joe Patterson -\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "17"
            },
            "excerpt": "n -\" /> <meta property=\"og:type\" content=\"website\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "18"
            },
            "excerpt": "ite\" /> <meta property=\"og:title\" content=\"Joe Patterson\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "19"
            },
            "excerpt": "son\" /> <meta property=\"og:description\" content=\"Joe Patterson for Assembly\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "20"
            },
            "excerpt": "bly\" /> <meta property=\"og:url\" content=\"https://joepatterson.com/\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "21"
            },
            "excerpt": "om/\" /> <meta property=\"og:image\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "22"
            },
            "excerpt": "jpg\" /> <meta property=\"og:image:secure_url\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "23"
            },
            "excerpt": "jpg\" /> <meta property=\"og:image:width\" content=\"2048\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "24"
            },
            "excerpt": "048\" /> <meta property=\"og:image:height\" content=\"1365\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "25"
            },
            "excerpt": "365\" /> <meta name=\"twitter:card\" content=\"summary\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "26"
            },
            "excerpt": "ary\" /> <meta name=\"twitter:site\" content=\"@Patterdude\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "27"
            },
            "excerpt": "ude\" /> <meta name=\"twitter:title\" content=\"Joe Patterson\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "28"
            },
            "excerpt": "son\" /> <meta name=\"twitter:description\" content=\"Joe Patterson for Assembly\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "29"
            },
            "excerpt": "bly\" /> <meta name=\"twitter:creator\" content=\"@Patterdude\" /> <me"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "30"
            },
            "excerpt": "ude\" /> <meta name=\"twitter:image\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" /> <sc"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "36"
            },
            "excerpt": " SEO --> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "37"
            },
            "excerpt": "s.com' /> <link rel=\"alternate\" type=\"application/rss+xml\" title=\"Joe Patterson &raquo; Feed\" href=\"https://joepatterson.com/feed/\" /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "38"
            },
            "excerpt": "feed/\" /> <link rel=\"alternate\" type=\"application/rss+xml\" title=\"Joe Patterson &raquo; Comments Feed\" href=\"https://joepatterson.com/comments/feed/\" /> <!-"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "62"
            },
            "excerpt": "</style> <link rel='stylesheet' id='astra-theme-css-css' href='https://joepatterson.com/wp-content/themes/astra/assets/css/minified/main.min.css?ver=3.7.10' media='all' /> <styl"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "66"
            },
            "excerpt": " </style> <link rel='stylesheet' id='wp-block-library-css' href='https://joepatterson.com/wp-includes/css/dist/block-library/style.min.css?ver=6.2.2' media='all' /> <styl"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "73"
            },
            "excerpt": " </style> <link rel='stylesheet' id='brizy-asset-google-10-css' class=\"brz-link brz-link-google\" type=\"text/css\" href='https://fonts.googleapis.com/css?family=Overpass%3A100%2C100italic%2C200%2C200ita ... 2Ccyrillic%2Ccyrillic-ext%2Cdevanagari%2Cgreek%2Cgreek-ext%2Cgujarati%2Chebrew%2Ckhmer%2Ckorean%2Clatin-ext%2Ctamil%2Ctelugu%2Cthai%2Cvietnamese&#038;display=swap&#038;ver=2.3.35' media='all' /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "74"
            },
            "excerpt": "='all' /> <link rel='stylesheet' id='brizy-asset-group-1-20-css' class=\"brz-link brz-link-preview-lib\" data-group=\"group-1\" href='https://joepatterson.com/wp-content/plugins/brizy/public/editor-build/232-wp/editor/css/group-1.css?ver=2.3.35' media='all' /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "75"
            },
            "excerpt": "='all' /> <link rel='stylesheet' id='brizy-asset-group-2-21-css' class=\"brz-link brz-link-preview-lib-pro\" data-group=\"group-2\" href='https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/group-2-pro.css?ver=2.3.28' media='all' /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "76"
            },
            "excerpt": "='all' /> <link rel='stylesheet' id='brizy-asset-main-30-css' class=\"brz-link brz-link-preview-pro\" href='https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/preview.pro.css?ver=2.3.28' media='all' /> <styl"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "91"
            },
            "excerpt": "</script> <link rel=\"https://api.w.org/\" href=\"https://joepatterson.com/wp-json/\" /><link "
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "91"
            },
            "excerpt": "-json/\" /><link rel=\"alternate\" type=\"application/json\" href=\"https://joepatterson.com/wp-json/wp/v2/pages/16\" /><link "
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "91"
            },
            "excerpt": "ges/16\" /><link rel=\"EditURI\" type=\"application/rsd+xml\" title=\"RSD\" href=\"https://joepatterson.com/xmlrpc.php?rsd\" /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "92"
            },
            "excerpt": "p?rsd\" /> <link rel=\"wlwmanifest\" type=\"application/wlwmanifest+xml\" href=\"https://joepatterson.com/wp-includes/wlwmanifest.xml\" /> <meta"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "93"
            },
            "excerpt": "t.xml\" /> <meta name=\"generator\" content=\"WordPress 6.2.2\" /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "94"
            },
            "excerpt": "6.2.2\" /> <link rel='shortlink' href='https://joepatterson.com/' /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "95"
            },
            "excerpt": ".com/' /> <link rel=\"alternate\" type=\"application/json+oembed\" href=\"https://joepatterson.com/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fjoepatterson.com%2F\" /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "96"
            },
            "excerpt": "om%2F\" /> <link rel=\"alternate\" type=\"text/xml+oembed\" href=\"https://joepatterson.com/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fjoepatterson.com%2F&#038;format=xml\" /> <meta"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "97"
            },
            "excerpt": "t=xml\" /> <meta name=\"facebook-domain-verification\" content=\"1tt0ezdlks2lf51jfn2nqzm3lnirj0\" /> <!-- "
          },
          {
            "ruleID": "Bad start tag in img in noscript in head.",
            "what": "Bad start tag in img in noscript in head.",
            "ordinalSeverity": 2,
            "tagName": "NOSCRIPT",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "113"
            },
            "excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
          },
          {
            "ruleID": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
            "what": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
            "ordinalSeverity": 2,
            "tagName": "NOSCRIPT",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "113"
            },
            "excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "NOSCRIPT",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "113"
            },
            "excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
          },
          {
            "ruleID": "Stray end tag noscript.",
            "what": "Stray end tag noscript.",
            "ordinalSeverity": 2,
            "tagName": "",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "113"
            },
            "excerpt": "ript=1\" /></noscript> <!-- "
          },
          {
            "ruleID": "The type attribute is unnecessary for JavaScript resources.",
            "what": "The type attribute is unnecessary for JavaScript resources.",
            "ordinalSeverity": 0,
            "tagName": "SCRIPT",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "116"
            },
            "excerpt": "MODIFY --><script src='https://secure.adnxs.com/seg?add=30067132&t=1' type='text/javascript'></scri"
          },
          {
            "ruleID": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
            "what": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
            "ordinalSeverity": 2,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "118"
            },
            "excerpt": "MODIFY --><img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\" /><!-- E"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "118"
            },
            "excerpt": "MODIFY --><img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\" /><!-- E"
          },
          {
            "ruleID": "The type attribute is unnecessary for JavaScript resources.",
            "what": "The type attribute is unnecessary for JavaScript resources.",
            "ordinalSeverity": 0,
            "tagName": "SCRIPT",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "120"
            },
            "excerpt": " Code --> <script type='text/javascript'> !func"
          },
          {
            "ruleID": "The type attribute is unnecessary for JavaScript resources.",
            "what": "The type attribute is unnecessary for JavaScript resources.",
            "ordinalSeverity": 0,
            "tagName": "SCRIPT",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "128"
            },
            "excerpt": " Code --> <script type='text/javascript'> fbq"
          },
          {
            "ruleID": "The type attribute is unnecessary for JavaScript resources.",
            "what": "The type attribute is unnecessary for JavaScript resources.",
            "ordinalSeverity": 0,
            "tagName": "SCRIPT",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "132"
            },
            "excerpt": " </script><script type='text/javascript'> fbq"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "138"
            },
            "excerpt": "noscript> <img height=\"1\" width=\"1\" style=\"display:none\" alt=\"fbpx\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /> </nos"
          },
          {
            "ruleID": "Attribute name not allowed on element meta at this point.",
            "what": "Attribute name not allowed on element meta at this point.",
            "ordinalSeverity": 2,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "141"
            },
            "excerpt": " Code --> <meta name=\"viewport\" content=\"width=device-width, initial-scale=1\"> <link"
          },
          {
            "ruleID": "Element meta is missing one or more of the following attributes: itemprop, property.",
            "what": "Element meta is missing one or more of the following attributes: itemprop, property.",
            "ordinalSeverity": 2,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "141"
            },
            "excerpt": " Code --> <meta name=\"viewport\" content=\"width=device-width, initial-scale=1\"> <link"
          },
          {
            "ruleID": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
            "what": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
            "ordinalSeverity": 2,
            "tagName": "STYLE",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "143"
            },
            "excerpt": "ssorigin> <style class=\"brz-style\">.brz ."
          },
          {
            "ruleID": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
            "what": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
            "ordinalSeverity": 2,
            "tagName": "STYLE",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "143"
            },
            "excerpt": "}}</style><style class=\"brz-style\">@media"
          },
          {
            "ruleID": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
            "what": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
            "ordinalSeverity": 2,
            "tagName": "",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "154"
            },
            "excerpt": "x + 10px + 10px); padding-righ"
          },
          {
            "ruleID": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
            "what": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
            "ordinalSeverity": 2,
            "tagName": "",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "154"
            },
            "excerpt": "x + 10px + 10px); padding-righ"
          },
          {
            "ruleID": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
            "what": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
            "ordinalSeverity": 2,
            "tagName": "",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "154"
            },
            "excerpt": "x + 10px + 10px); padding-righ"
          },
          {
            "ruleID": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
            "what": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
            "ordinalSeverity": 2,
            "tagName": "",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "204"
            },
            "excerpt": "x + 10px + 10px); padding-righ"
          },
          {
            "ruleID": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
            "what": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
            "ordinalSeverity": 2,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "349"
            },
            "excerpt": " </style> <link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\" /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "349"
            },
            "excerpt": " </style> <link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\" /> <link"
          },
          {
            "ruleID": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
            "what": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
            "ordinalSeverity": 2,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "350"
            },
            "excerpt": "32x32\" /> <link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\" /> <link"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "350"
            },
            "excerpt": "32x32\" /> <link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\" /> <link"
          },
          {
            "ruleID": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
            "what": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
            "ordinalSeverity": 2,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "351"
            },
            "excerpt": "2x192\" /> <link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\" /> <meta"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "351"
            },
            "excerpt": "2x192\" /> <link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\" /> <meta"
          },
          {
            "ruleID": "Attribute name not allowed on element meta at this point.",
            "what": "Attribute name not allowed on element meta at this point.",
            "ordinalSeverity": 2,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "352"
            },
            "excerpt": "0.jpg\" /> <meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" /> </hea"
          },
          {
            "ruleID": "Element meta is missing one or more of the following attributes: itemprop, property.",
            "what": "Element meta is missing one or more of the following attributes: itemprop, property.",
            "ordinalSeverity": 2,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "352"
            },
            "excerpt": "0.jpg\" /> <meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" /> </hea"
          },
          {
            "ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
            "ordinalSeverity": -1,
            "tagName": "META",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "352"
            },
            "excerpt": "0.jpg\" /> <meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" /> </hea"
          },
          {
            "ruleID": "Stray end tag head.",
            "what": "Stray end tag head.",
            "ordinalSeverity": 2,
            "tagName": "BODY",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "353"
            },
            "excerpt": "0.jpg\" /> </head> <body"
          },
          {
            "ruleID": "Start tag body seen but an element of the same type was already open.",
            "what": "Start tag body seen but an element of the same type was already open.",
            "ordinalSeverity": 2,
            "tagName": "BODY",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "354"
            },
            "excerpt": "> </head> <body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz\"> <"
          },
          {
            "ruleID": "Cannot recover after last error. Any further errors will be ignored.",
            "what": "Cannot recover after last error. Any further errors will be ignored.",
            "ordinalSeverity": 3,
            "tagName": "BODY",
            "id": "",
            "location": {
              "doc": "source",
              "type": "line",
              "spec": "354"
            },
            "excerpt": "> </head> <body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz\"> <"
          }
        ]
      },
      "endTime": 1687099526983
    },
    {
      "type": "test",
      "which": "qualWeb",
      "withNewContent": false,
      "startTime": 1687099526983,
      "url": "https://joepatterson.com/",
      "what": "QualWeb",
      "result": {
        "type": "evaluation",
        "system": {
          "name": "QualWeb",
          "description": "QualWeb is an automatic accessibility evaluator for webpages.",
          "version": "3.0.0",
          "homepage": "http://www.qualweb.di.fc.ul.pt/",
          "date": "2023-06-18 14:45:28",
          "hash": "4d4df931257f15a0febc57e078572f10d1b1a648e676e1bd8aaea0741f200ba696b907b4873ec93b93f926cbbbebd88e9d393647b8760689d13d7ddbd07cd5d9",
          "page": {
            "viewport": {
              "mobile": false,
              "landscape": true,
              "userAgent": "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) HeadlessChrome/100.0.4889.0 Safari/537.36",
              "resolution": {
                "width": 1366,
                "height": 768
              }
            }
          }
        },
        "metadata": {
          "passed": 23,
          "warning": 11,
          "failed": 12,
          "inapplicable": 79
        },
        "modules": {
          "act-rules": {
            "type": "act-rules",
            "metadata": {
              "passed": 9,
              "warning": 8,
              "failed": 5,
              "inapplicable": 45
            },
            "assertions": {
              "QW-ACT-R63": {
                "name": "Document has a landmark with non-repeated content",
                "code": "QW-ACT-R63",
                "mapping": "b40fd1",
                "description": "This rule checks that each page has an element with a landmark semantic role starting with non-repeated content",
                "metadata": {
                  "target": {
                    "element": "html"
                  },
                  "success-criteria": [],
                  "related": [],
                  "url": "https://act-rules.github.io/rules/b40fd1",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 0,
                  "warning": 1,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "Check either there is no non-repeated content after repeated content or there exists an element for which all the following are true: - the element has semantic role inheriting from landmark; and - the first perceivable content (in tree order in the flat tree) which is an inclusive descendant of the element is non-repeated content after repeated content; and - the element is included in the accessibility tree."
                },
                "results": [
                  {
                    "verdict": "warning",
                    "description": "Check either there is no non-repeated content after repeated content or there exists an element for which all the following are true: - the element has semantic role inheriting from landmark; and - the first perceivable content (in tree order in the flat tree) which is an inclusive descendant of the element is non-repeated content after repeated content; and - the element is included in the accessibility tree.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>",
                        "pointer": "html"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R64": {
                "name": "Document has heading for non-repeated content",
                "code": "QW-ACT-R64",
                "mapping": "047fe0",
                "description": "This rule checks that the non-repeated content contains a heading",
                "metadata": {
                  "target": {
                    "element": "html"
                  },
                  "success-criteria": [],
                  "related": [
                    "H69"
                  ],
                  "url": "https://act-rules.github.io/rules/047fe0",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 0,
                  "warning": 1,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "Check either there is no non-repeated content after repeated content or there exists an element for which all the following are true: - the element is non-repeated content after repeated content; and - the element has a semantic role of heading; and - the element is visible; and - the element is included in the accessibility tree."
                },
                "results": [
                  {
                    "verdict": "warning",
                    "description": "Check either there is no non-repeated content after repeated content or there exists an element for which all the following are true: - the element is non-repeated content after repeated content; and - the element has a semantic role of heading; and - the element is visible; and - the element is included in the accessibility tree.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>",
                        "pointer": "html"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R73": {
                "name": "Block of repeated content is collapsible",
                "code": "QW-ACT-R73",
                "mapping": "3e12e1",
                "description": "This rule checks that repeated blocks of content are collapsible.",
                "metadata": {
                  "target": {
                    "element": "html"
                  },
                  "success-criteria": [],
                  "related": [
                    "SCR28"
                  ],
                  "url": "https://act-rules.github.io/rules/3e12e1",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 0,
                  "warning": 1,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "For each block of repeated content in each test target, which is before (in the flat tree) at least one node of non-repeated content after repeated content, check that all the following are true: - there exists an instrument to make all nodes in this block not visible; and - there exists an instrument to remove all nodes in this block from the accessibility tree."
                },
                "results": [
                  {
                    "verdict": "warning",
                    "description": "For each block of repeated content in each test target, which is before (in the flat tree) at least one node of non-repeated content after repeated content, check that all the following are true: - there exists an instrument to make all nodes in this block not visible; and - there exists an instrument to remove all nodes in this block from the accessibility tree.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>",
                        "pointer": "html"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R74": {
                "name": "Document has an instrument to move focus to non-repeated content",
                "code": "QW-ACT-R74",
                "mapping": "ye5d6e",
                "description": "This rule checks that there is an instrument to move focus to non-repeated content in the page.",
                "metadata": {
                  "target": {
                    "element": "html"
                  },
                  "success-criteria": [],
                  "related": [
                    "G1",
                    "G123",
                    "G124"
                  ],
                  "url": "https://act-rules.github.io/rules/ye5d6e",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 0,
                  "warning": 1,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "The page has one or more instrument(s) to move focus. Check if any of these instrument(s) is being used before a block of repeated content, and the focus is moved to just before a block of non-repeated content."
                },
                "results": [
                  {
                    "verdict": "warning",
                    "description": "The page has one or more instrument(s) to move focus. Check if any of these instrument(s) is being used before a block of repeated content, and the focus is moved to just before a block of non-repeated content.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>",
                        "pointer": "html"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R12": {
                "name": "Link has accessible name",
                "code": "QW-ACT-R12",
                "mapping": "c487ae",
                "description": "This rule checks that each link has an accessible name.",
                "metadata": {
                  "target": {
                    "element": [
                      "a[href]",
                      "area[href]"
                    ],
                    "attributes": [
                      "role='link'"
                    ]
                  },
                  "success-criteria": [
                    {
                      "name": "2.4.4",
                      "level": "A",
                      "principle": "Operable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/link-purpose-in-context",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#link-purpose-in-context"
                    },
                    {
                      "name": "2.4.9",
                      "level": "AAA",
                      "principle": "Operable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/link-purpose-link-only",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#link-purpose-link-only"
                    },
                    {
                      "name": "4.1.2",
                      "level": "A",
                      "principle": "Robust",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/name-role-value",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#name-role-value"
                    }
                  ],
                  "related": [
                    "G91"
                  ],
                  "url": "https://act-rules.github.io/rules/c487ae",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 18,
                  "warning": 0,
                  "failed": 3,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "The test target doesn't have an accessible name, or it's empty ('')."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "The test target doesn't have an accessible name, or it's empty ('').",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)",
                        "accessibleName": ""
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target doesn't have an accessible name, or it's empty ('').",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)",
                        "accessibleName": ""
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target doesn't have an accessible name, or it's empty ('').",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1)",
                        "accessibleName": ""
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R18": {
                "name": "`id` attribute value is unique",
                "code": "QW-ACT-R18",
                "mapping": "3ea0c8",
                "description": "This rule checks that all id attribute values on a single page are unique.",
                "metadata": {
                  "target": {
                    "element": "*"
                  },
                  "success-criteria": [
                    {
                      "name": "4.1.1",
                      "level": "A",
                      "principle": "Robust",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/parsing.html",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#parsing"
                    }
                  ],
                  "related": [
                    "H93"
                  ],
                  "url": "https://act-rules.github.io/rules/3ea0c8",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 67,
                  "warning": 0,
                  "failed": 3,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "Several elements have the same `id` attribute."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "Several elements have the same `id` attribute.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<script type=\"text/javascript\" id=\"www-widgetapi-script\" src=\"https://www.youtube.com/s/player/6ed0d907/www-widgetapi.vflset/www-widgetapi.js\" async=\"\"></script>",
                        "pointer": "html > head:nth-child(1) > script:nth-child(25)"
                      },
                      {
                        "htmlCode": "<script type=\"text/javascript\" id=\"www-widgetapi-script\" src=\"https://www.youtube.com/s/player/6ed0d907/www-widgetapi.vflset/www-widgetapi.js\" async=\"\"></script>",
                        "pointer": "html > head:nth-child(1) > script:nth-child(27)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Several elements have the same `id` attribute.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">   </g>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1)"
                      },
                      {
                        "htmlCode": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">   </g>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Several elements have the same `id` attribute.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(1)"
                      },
                      {
                        "htmlCode": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(2)"
                      },
                      {
                        "htmlCode": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(1)"
                      },
                      {
                        "htmlCode": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(2)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R62": {
                "name": "Element in sequential focus order has visible focus",
                "code": "QW-ACT-R62",
                "mapping": "oj04fd",
                "description": "This rule checks that each element in sequential focus order has some visible focus indication.",
                "metadata": {
                  "target": {
                    "element": "*"
                  },
                  "success-criteria": [
                    {
                      "name": "2.4.7",
                      "level": "AA",
                      "principle": "Operable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/focus-visible.html",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#focus-visible"
                    }
                  ],
                  "related": [],
                  "url": "https://act-rules.github.io/rules/oj04fd",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 0,
                  "warning": 34,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "Check if the element has some visible focus indication"
                },
                "results": [
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">Home</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">Meet Joe</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">News</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">AD5</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">Issues</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">DONATE</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">$5</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">$10</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">$25</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">$50</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">$75</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">OTHER</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email *\" data-placeholder=\"Email *\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj\" data-custom-id=\"nxouluvbretczsumlwfttgzfltqnntvlwvaf\">SUBMIT    !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationFrame(t.triggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this.start=t);var n=t-thi …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\">Learn More</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email*\" data-placeholder=\"Email*\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-dyvgx\" data-custom-id=\"pctxnochcdlwubleyhhicvdleifnqiyrttuh\">Endorse Joe!    !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationFrame(t.triggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this. …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > button:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">Home</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">Meet Joe</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">News</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">AD5</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">Issues</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email Updates\" data-placeholder=\"Email Updates\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-rplcf\" data-custom-id=\"urngpgulgkggkfoivjalbjunpabjeeujtqmh\">SUBMIT    !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationFrame(t.triggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this.start= …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if the element has some visible focus indication",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R41": {
                "name": "Error message describes invalid form field value",
                "code": "QW-ACT-R41",
                "mapping": "36b590",
                "description": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
                "metadata": {
                  "target": {
                    "element": [
                      "input",
                      "select",
                      "textarea",
                      "*[role]"
                    ]
                  },
                  "success-criteria": [
                    {
                      "name": "3.3.1",
                      "level": "A",
                      "principle": "Understandable",
                      "url": "https://www.w3.org/TR/WCAG21/#error-identification",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#error-identification"
                    }
                  ],
                  "related": [],
                  "url": "https://act-rules.github.io/rules/36b590",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 0,
                  "warning": 10,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "Check that text error messages provided, identify the cause of the error or how to fix the error."
                },
                "results": [
                  {
                    "verdict": "warning",
                    "description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email *\" data-placeholder=\"Email *\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email*\" data-placeholder=\"Email*\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@&quot;]+)*)|(&quot;.+&quot;))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email Updates\" data-placeholder=\"Email Updates\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R17": {
                "name": "Image has accessible name",
                "code": "QW-ACT-R17",
                "mapping": "23a2a8",
                "description": "This rule checks that each image that is not marked as decorative, has an accessible name.",
                "metadata": {
                  "target": {
                    "element": "img"
                  },
                  "success-criteria": [
                    {
                      "name": "1.1.1",
                      "level": "A",
                      "principle": "Understandable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/non-text-content.html",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#non-text-content"
                    }
                  ],
                  "related": [
                    "G94",
                    "G95"
                  ],
                  "url": "https://act-rules.github.io/rules/23a2a8",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 3,
                  "warning": 0,
                  "failed": 1,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "The test target doesn't have an accessible name."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "The test target doesn't have an accessible name.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<img src=\"http://ib.adnxs.com/seg?add=30067132&amp;t=2\" width=\"1\" height=\"1\">",
                        "pointer": "html > body:nth-child(2) > img:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R37": {
                "name": "Text has minimum contrast",
                "code": "QW-ACT-R37",
                "mapping": "afw4f7",
                "description": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
                "metadata": {
                  "target": {
                    "element": [
                      "*"
                    ]
                  },
                  "success-criteria": [
                    {
                      "name": "1.4.3",
                      "level": "A",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/contrast-minimum.html",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#contrast-minimum"
                    },
                    {
                      "name": "1.4.6",
                      "level": "AA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/contrast-enhanced.html",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#contrast-enhanced"
                    }
                  ],
                  "related": [],
                  "url": "https://act-rules.github.io/rules/afw4f7",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 16,
                  "warning": 0,
                  "failed": 10,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "Element has contrast ratio lower than minimum."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Home</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">News</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">AD5</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Issues</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Home</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">News</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">AD5</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Issues</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R76": {
                "name": "Text has enhanced contrast",
                "code": "QW-ACT-R76",
                "mapping": "09o5cg",
                "description": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
                "metadata": {
                  "target": {
                    "element": "*"
                  },
                  "success-criteria": [
                    {
                      "name": "1.4.6",
                      "level": "AAA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/contrast-enhanced.html",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#contrast-enhanced"
                    }
                  ],
                  "related": [
                    "G17",
                    "G18"
                  ],
                  "url": "https://act-rules.github.io/rules/09o5cg",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 14,
                  "warning": 0,
                  "failed": 12,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "Element has contrast ratio lower than minimum."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Home</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">News</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">AD5</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Issues</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Home</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">News</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">AD5</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Issues</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Element has contrast ratio lower than minimum.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R75": {
                "name": "Bypass Blocks of Repeated Content",
                "code": "QW-ACT-R75",
                "mapping": "cf77f2",
                "description": "This rule checks that each page has a mechanism to bypass repeated blocks of content.",
                "metadata": {
                  "target": {
                    "element": "html"
                  },
                  "success-criteria": [
                    {
                      "name": "2.4.1",
                      "level": "A",
                      "principle": "Operable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/bypass-blocks.html",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#bypass-blocks"
                    }
                  ],
                  "related": [
                    "G1",
                    "G123",
                    "G124",
                    "H69",
                    "SCR28"
                  ],
                  "url": "https://act-rules.github.io/rules/cf77f2",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 0,
                  "warning": 1,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "The rule can't tell because of the rule QW-ACT-R63"
                },
                "results": [
                  {
                    "verdict": "warning",
                    "description": "The rule can't tell because of the rule QW-ACT-R63",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body>Joe Patterson\n\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\t{\"@context\":\"https:\\/\\/schema.org\",\"@graph\":[{\"@type\":\"WebSite\",\"@id\":\"https:\\/\\/joepatterson.com\\/#website\",\"url\":\"https:\\/\\/joepatterson.com\\/\",\"name\":\"Joe Patterson\",\"inLanguage\":\"en-US\",\"publisher\":{\"@id\":\"https:\\/\\/joepatterson.com\\/#organization\"},\"potentialAction\":{\"@type\":\"SearchAction\",\"target\":{\"@type\":\"EntryPoint\",\"urlTemplate\":\"https:\\/\\/joepatterson.com\\/?s={search_term_string}\"},\"query-input\":\"required name=search_term_string\"}},{\"@type\":\"Organization\",\"@id\":\"https:\\/\\/joepatterson.com\\/#organization\",\"name\":\"Joe Pat …",
                        "pointer": "html"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-ACT-R40": {
                "name": "Zoomed text node is not clipped with CSS overflow",
                "code": "QW-ACT-R40",
                "mapping": "59br37",
                "description": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
                "metadata": {
                  "target": {
                    "element": "*:text()"
                  },
                  "success-criteria": [
                    {
                      "name": "1.4.4",
                      "level": "AA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/resize-text.html",
                      "url_tr": "https://www.w3.org/TR/WCAG21/#resize-text"
                    }
                  ],
                  "related": [],
                  "url": "https://act-rules.github.io/rules/59br37",
                  "type": [
                    "ACTRule",
                    "TestCase"
                  ],
                  "a11yReq": [],
                  "passed": 0,
                  "warning": 34,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "Check if each ancestor or the text node is not clipped by overflow."
                },
                "results": [
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Home</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">News</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">AD5</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Issues</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">DONATE</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(2)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color3\">THANK YOU!</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color3\">-Joe Patterson </span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color8\">STAND WITH JOE:</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">$5</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">$10</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">$25</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">$50</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">$75</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">OTHER</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color1\">Meet Joe Patterson</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">Learn More</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<strong class=\"brz-cp-color8\">Endorse Joe</strong>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">Endorse Joe!</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > button:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Home</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">News</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">AD5</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span\">Issues</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color8\">Paid for by Joe Patterson for Assembly 2024 FPPC ID</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color8 brz-pre-population-visible\"># </span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(2)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check if each ancestor or the text node is not clipped by overflow.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color8\">1456524</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(3)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              }
            }
          },
          "wcag-techniques": {
            "type": "wcag-techniques",
            "metadata": {
              "passed": 3,
              "warning": 2,
              "failed": 6,
              "inapplicable": 23
            },
            "assertions": {
              "QW-WCAG-T23": {
                "name": "Adding a link at the top of each page that goes directly to the main content area",
                "code": "QW-WCAG-T23",
                "mapping": "G1",
                "description": "The objective of this technique is to provide a mechanism to bypass blocks of material that are repeated on multiple Web pages by skipping directly to the main content of the Web page.",
                "metadata": {
                  "target": {
                    "element": "body"
                  },
                  "success-criteria": [
                    {
                      "name": "2.4.1",
                      "level": "A",
                      "principle": "Operable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/bypass-blocks"
                    }
                  ],
                  "related": [
                    "G123",
                    "G124"
                  ],
                  "url": "https://www.w3.org/WAI/WCAG21/Techniques/general/G1",
                  "passed": 0,
                  "warning": 0,
                  "failed": 1,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "The first focusable control on the Web page does not links to local content."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "The first focusable control on the Web page does not links to local content.",
                    "resultCode": "F3",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-WCAG-T21": {
                "name": "Failure of Success Criteria 2.4.4, 2.4.9 and 4.1.2 due to not providing an accessible name for an image which is the only content in a link",
                "code": "QW-WCAG-T21",
                "mapping": "F89",
                "description": "This technique checks the text alternative of images which are the only content of a link",
                "metadata": {
                  "target": {
                    "parent": "a",
                    "element": "img"
                  },
                  "success-criteria": [
                    {
                      "name": "2.4.4",
                      "level": "A",
                      "principle": "Operable",
                      "url": "https://www.w3.org/TR/UNDERSTANDING-WCAG20/navigation-mechanisms-refs.html"
                    },
                    {
                      "name": "2.4.9",
                      "level": "AAA",
                      "principle": "Operable",
                      "url": "https://www.w3.org/TR/UNDERSTANDING-WCAG20/navigation-mechanisms-link.html"
                    },
                    {
                      "name": "4.1.2",
                      "level": "A",
                      "principle": "Robust",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/name-role-value"
                    }
                  ],
                  "related": [
                    "H2",
                    "H30",
                    "ARIA7",
                    "ARIA8"
                  ],
                  "url": "https://www.w3.org/WAI/WCAG21/Techniques/failures/F89",
                  "passed": 0,
                  "warning": 0,
                  "failed": 1,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "The image doesn't have an accessible name."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "The image doesn't have an accessible name.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-WCAG-T15": {
                "name": "Using the link element and navigation tools",
                "code": "QW-WCAG-T15",
                "mapping": "H59",
                "description": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
                "metadata": {
                  "target": {
                    "element": "link"
                  },
                  "success-criteria": [
                    {
                      "name": "2.4.5",
                      "level": "AA",
                      "principle": "Operable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/multiple-ways"
                    },
                    {
                      "name": "2.4.8",
                      "level": "AAA",
                      "principle": "Operable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/location"
                    }
                  ],
                  "related": [
                    "G1",
                    "G63",
                    "G64",
                    "G123"
                  ],
                  "url": "https://www.w3.org/WAI/WCAG21/Techniques/html/H59",
                  "passed": 6,
                  "warning": 6,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>"
                },
                "results": [
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"profile\" href=\"http://gmpg.org/xfn/11\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(2)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"pingback\" href=\"https://joepatterson.com/xmlrpc.php\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(3)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(31)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"stylesheet\" id=\"astra-theme-css-css\" href=\"https://joepatterson.com/wp-content/themes/astra/assets/css/minified/main.min.css?ver=3.7.10\" media=\"all\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(36)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"stylesheet\" id=\"wp-block-library-css\" href=\"https://joepatterson.com/wp-includes/css/dist/block-library/style.min.css?ver=6.2.2\" media=\"all\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(38)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"stylesheet\" id=\"brizy-asset-google-10-css\" class=\"brz-link brz-link-google\" type=\"text/css\" href=\"https://fonts.googleapis.com/css?family=Overpass%3A100%2C100italic%2C200%2C200italic%2C300%2C300italic%2Cregular%2Citalic%2C600%2C600italic%2C700%2C700italic%2C800%2C800italic%2C900%2C900italic%7CMontserrat%3A100%2C100italic%2C200%2C200italic%2C300%2C300italic%2Cregular%2Citalic%2C500%2C500italic%2C600%2C600italic%2C700%2C700italic%2C800%2C800italic%2C900%2C900italic%7CLato%3A100%2C100italic%2C300%2C300italic%2Cregular%2Citalic%2C700%2C700italic%2C900%2C900italic%7CRed+Hat+Text%3Aregular%2Citalic%2C500%2C500italic%2C700%2C700italic&amp;subset=arabic%2Cbengali%2Ccyrillic%2Ccyrillic-ext …",
                        "pointer": "html > head:nth-child(1) > link:nth-child(40)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"stylesheet\" id=\"brizy-asset-group-1-20-css\" class=\"brz-link brz-link-preview-lib\" data-group=\"group-1\" href=\"https://joepatterson.com/wp-content/plugins/brizy/public/editor-build/232-wp/editor/css/group-1.css?ver=2.3.35\" media=\"all\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(41)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"stylesheet\" id=\"brizy-asset-group-2-21-css\" class=\"brz-link brz-link-preview-lib-pro\" data-group=\"group-2\" href=\"https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/group-2-pro.css?ver=2.3.28\" media=\"all\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(42)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"stylesheet\" id=\"brizy-asset-main-30-css\" class=\"brz-link brz-link-preview-pro\" href=\"https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/preview.pro.css?ver=2.3.28\" media=\"all\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(43)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"https://api.w.org/\" href=\"https://joepatterson.com/wp-json/\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(48)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"EditURI\" type=\"application/rsd+xml\" title=\"RSD\" href=\"https://joepatterson.com/xmlrpc.php?rsd\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(50)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"wlwmanifest\" type=\"application/wlwmanifest+xml\" href=\"https://joepatterson.com/wp-includes/wlwmanifest.xml\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(51)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "inapplicable",
                    "description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
                    "resultCode": "I2",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"shortlink\" href=\"https://joepatterson.com/\">",
                        "pointer": "html > head:nth-child(1) > link:nth-child(53)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
                    "resultCode": "RC1",
                    "elements": [
                      {
                        "htmlCode": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//ajax.googleapis.com\">",
                        "pointer": "html > body:nth-child(2) > link:nth-child(7)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
                    "resultCode": "RC1",
                    "elements": [
                      {
                        "htmlCode": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">",
                        "pointer": "html > body:nth-child(2) > link:nth-child(8)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
                    "resultCode": "RC1",
                    "elements": [
                      {
                        "htmlCode": "<link class=\"brz-link brz-link-google-preconnect\" rel=\"preconnect\" href=\"https://fonts.gstatic.com/\" crossorigin=\"\">",
                        "pointer": "html > body:nth-child(2) > link:nth-child(9)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
                    "resultCode": "RC1",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\">",
                        "pointer": "html > body:nth-child(2) > link:nth-child(12)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
                    "resultCode": "RC1",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\">",
                        "pointer": "html > body:nth-child(2) > link:nth-child(13)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
                    "resultCode": "RC1",
                    "elements": [
                      {
                        "htmlCode": "<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\">",
                        "pointer": "html > body:nth-child(2) > link:nth-child(14)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-WCAG-T32": {
                "name": "Using ol, ul and dl for lists or groups of links",
                "code": "QW-WCAG-T32",
                "mapping": "H48",
                "description": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
                "metadata": {
                  "target": {
                    "element": [
                      "li",
                      "dd",
                      "dt"
                    ]
                  },
                  "success-criteria": [
                    {
                      "name": "1.3.1",
                      "level": "A",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/info-and-relationships"
                    }
                  ],
                  "related": [
                    "H40"
                  ],
                  "url": "https://www.w3.org/WAI/WCAG21/Techniques/html/H48",
                  "passed": 0,
                  "warning": 6,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list."
                },
                "results": [
                  {
                    "verdict": "warning",
                    "description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<ul class=\"brz-menu__ul brz-mm-listview\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-mm-menu__item brz-mm-menu__item-empty brz-mm-menu__item--current brz-mm-listitem\" data-menu-item-id=\"b80377d0ea164df79e92847fe9d7db93\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item brz-mm-listitem__text\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(1) > a:nth-child(1)\" _cssrules=\"true\"><span class=\"brz-span\" _sele …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<ul class=\"brz-mm-menu__sub-menu brz-menu__ul--has-dropdown brz-mm-listview\"><li class=\"brz-mm-menu__item brz-mm-menu__item-empty brz-mm-listitem\" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page brz-mm-listitem__text\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"external\" id=\"\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > div:nth-child(3) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)\" _cssrules=\"true\"><span class=\"brz-span\" _selector=\"html > body:nth-child(2) > div:nth-child(24) >  …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > div:nth-child(3) > ul:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<ul class=\"brz-menu__ul\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-menu__item brz-menu__item--current\" data-menu-item-id=\"b80377d0ea164df79e92847fe9d7db93\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" _cssrules=\"true\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-c …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22%2C%22tablet%22%3A%22bottom-start%22%2C%22mobile%22%3A%22bottom-start%22%7D%7D\" class=\"brz-menu__dropdown brz-menu__sub-menu\" style=\"--offset: 5px; position: absolute; inset: 0px auto auto 0px; margin: 0px; transform: translate(0px, 44px);\" data-popper-placement=\"bottom-start\"><li class=\"brz-menu__item\" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"e …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > ul:nth-child(2)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<ul class=\"brz-menu__ul\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-menu__item brz-menu__item--current\" data-menu-item-id=\"b80377d0ea164df79e92847fe9d7db93\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" _cssrules=\"true\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22%2C%22tablet%22%3A%22bottom-start%22%2C%22mobile%22%3A%22bottom-start%22%7D%7D\" class=\"brz-menu__dropdown brz-menu__sub-menu\" style=\"--offset: 5px; position: absolute; inset: auto auto 0px 0px; margin: 0px; transform: translate(0px, -43px);\" data-popper-reference-hidden=\"\" data-popper-escaped=\"\" data-popper-placement=\"top-start\"><li class=\"brz-menu__item\" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://jo …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > ul:nth-child(2)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-WCAG-T19": {
                "name": "Providing submit buttons",
                "code": "QW-WCAG-T19",
                "mapping": "H32",
                "description": "The objective of this technique is to provide a mechanism that allows users to explicitly request changes of context. The intended use of a submit button is to generate an HTTP request that submits data entered in a form, so it is an appropriate control to use for causing a change of context.",
                "metadata": {
                  "target": {
                    "element": "form"
                  },
                  "success-criteria": [
                    {
                      "name": "3.2.2",
                      "level": "A",
                      "principle": "Understandable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/on-input"
                    }
                  ],
                  "related": [
                    "G80",
                    "H36",
                    "H84"
                  ],
                  "url": "https://www.w3.org/WAI/WCAG21/Techniques/html/H32",
                  "passed": 0,
                  "warning": 0,
                  "failed": 3,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "Form tag doesn't contain any of the following elements input[type~='submit image'], button[type='submit']."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "Form tag doesn't contain any of the following elements input[type~='submit image'], button[type='submit'].",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"dskyguesfdwsuhockwwasaportijqvjngwsh\" data-project-id=\"9f61f1ac83161ffb9c881a4dedac45c2\" data-success=\"\" data-error=\"\" data-redirect=\"/confirmation/\">SUBMIT    !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationF …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Form tag doesn't contain any of the following elements input[type~='submit image'], button[type='submit'].",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"fbtlofiblnoutrunfzizbsdvloekmnvpisxn\" data-project-id=\"9f61f1ac83161ffb9c881a4dedac45c2\" data-success=\"Your endorsement was sent. Thank you.\" data-error=\"There was an error. Please\" data-redirect=\"/confirmation/\">Endorse Joe!    !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "Form tag doesn't contain any of the following elements input[type~='submit image'], button[type='submit'].",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"fonhcxfbmwbbacpwvgmiprkqrpdqrdbvdnrz\" data-project-id=\"9f61f1ac83161ffb9c881a4dedac45c2\" data-success=\"\" data-error=\"\" data-redirect=\"\">SUBMIT    !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationFrame(t.trigger …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              },
              "QW-WCAG-T28": {
                "name": "Using `percent, em, names` for font sizes",
                "code": "QW-WCAG-T28",
                "mapping": "C121314",
                "description": "This technique checks that all font-size attribute uses percent, em or names.",
                "metadata": {
                  "target": {
                    "element": "*",
                    "attributes": "font-size"
                  },
                  "success-criteria": [
                    {
                      "name": "1.4.4",
                      "level": "AA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/TR/UNDERSTANDING-WCAG20/visual-audio-contrast-scale.html"
                    },
                    {
                      "name": "1.4.5",
                      "level": "AA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/TR/UNDERSTANDING-WCAG20/visual-audio-contrast-text-presentation.html"
                    },
                    {
                      "name": "1.4.8",
                      "level": "AAA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/TR/UNDERSTANDING-WCAG20/visual-audio-contrast-visual-presentation.html"
                    },
                    {
                      "name": "1.4.9",
                      "level": "AAA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/GL/UNDERSTANDING-WCAG20/visual-audio-contrast-text-images.html"
                    }
                  ],
                  "related": [
                    "C12",
                    "C13",
                    "C14"
                  ],
                  "url": {
                    "C12": "https://www.w3.org/WAI/WCAG21/Techniques/css/C12",
                    "C13": "https://www.w3.org/WAI/WCAG21/Techniques/css/C13",
                    "C14": "https://www.w3.org/WAI/WCAG21/Techniques/css/C14"
                  },
                  "passed": 16,
                  "warning": 0,
                  "failed": 50,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "This test target has a font-size css property using an absolute unit value with the important flag."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-icon css-3z2g66\">  </span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "48px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-pzxzi\" data-uniq-id=\"ktmas\" data-generated-css=\"brz-css-xvlfv\"></p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "22px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\">     </svg>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "32px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-zctmh\" data-uniq-id=\"hlkbv\" data-generated-css=\"brz-css-yeiqu\">HOME</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading1FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">DONATE</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "30px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-css-oheuj\" data-type=\"glyph\" data-name=\"tail-right\"></svg>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > svg:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "16px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-icon css-1v9psv1\"></span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "48px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\">THANK YOU!</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "46px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-vtphm\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"> </p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading3FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading3FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\">-Joe Patterson </p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading3FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-icon css-1cnr1ql\"></span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "48px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-lkuyo\" data-generated-css=\"brz-css-kokqw\" data-uniq-id=\"hpxfi\">JOE PATTERSON</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "84px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-mkkan\" data-uniq-id=\"lwuac\" data-generated-css=\"brz-css-erjeq\">Your voice in the State Assembly.</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "44px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdggtybzbtscl\">$5</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "24px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufznyxypipympv\">$10</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "24px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurwjvjsywyumae\">$25</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "24px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-cbllz\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yemcvnewgngfymiotxewwyjzajhaeldnceah\">OTHER</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "24px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p data-uniq-id=\"qctya\" data-generated-css=\"brz-css-oooyn\" class=\"brz-css-yhukw\">STAND WITH JOE:</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "27px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">$5</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "24px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">$10</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "24px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">$25</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "24px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">$50</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "24px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">$75</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "24px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">OTHER</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "24px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p data-uniq-id=\"hwwdz\" data-generated-css=\"brz-css-owosm\" class=\"brz-css-dbkfe\">JOIN THE TEAM</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading1FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-gjenq\"></div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "18px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-sqjjw\"></div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2)"
                      }
                    ],
                    "attributes": [
                      "18px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk\"></div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3)"
                      }
                    ],
                    "attributes": [
                      "18px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-solsx\"></div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4)"
                      }
                    ],
                    "attributes": [
                      "18px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-xnabq\"></div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5)"
                      }
                    ],
                    "attributes": [
                      "18px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\">Meet Joe Patterson</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "56px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "20px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\">Learn More</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "25px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-bklfk\" data-uniq-id=\"qxpfh\" data-generated-css=\"brz-css-owucl\">Endorse Joe</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "44px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-ilwyl\"></div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "18px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-odtpn\"></div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2)"
                      }
                    ],
                    "attributes": [
                      "18px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-fyenv\"></div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3)"
                      }
                    ],
                    "attributes": [
                      "18px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-cbrxq\"></div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4)"
                      }
                    ],
                    "attributes": [
                      "18px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-ztibp brz-css-liimk brz-css-vgqwm\"></div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "18px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-icon css-1yqt0eo\"></span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "32px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-span brz-icon css-1ldonqd\"></span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "32px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\">     </svg>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "32px"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-rjztm\" data-uniq-id=\"hlkbv\" data-generated-css=\"brz-css-yeiqu\">HOME</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading1FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-xquao\" data-generated-css=\"brz-css-mqzvf\" data-uniq-id=\"fmuwc\">MEET JOE</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading1FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-yjyph\" data-uniq-id=\"lejsp\" data-generated-css=\"brz-css-fumnn\">NEWS</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading1FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-bwxye\" data-generated-css=\"brz-css-tujgm\" data-uniq-id=\"ulmaa\">AD5</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading1FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-wwpav\" data-uniq-id=\"qtxdk\" data-generated-css=\"brz-css-hhgpv\">ENDORSEMENTS</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading1FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-tbnau\" data-uniq-id=\"knloz\" data-generated-css=\"brz-css-opatl\">YARD SIGNS</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading1FontSize)"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a font-size css property using an absolute unit value with the important flag.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-dzpeg\" data-generated-css=\"brz-css-nsqiu\" data-uniq-id=\"dmvlt\">VOLUNTEER</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(7) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": [
                      "var(--brz-heading1FontSize)"
                    ]
                  }
                ]
              },
              "QW-WCAG-T29": {
                "name": "Specifying alignment either to the left or right in CSS",
                "code": "QW-WCAG-T29",
                "mapping": "C19",
                "description": "This technique describes how to align blocks of text either left or right by setting the CSS text-align property.",
                "metadata": {
                  "target": {
                    "element": "*",
                    "attributes": "text-align"
                  },
                  "success-criteria": [
                    {
                      "name": "1.4.8",
                      "level": "AAA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/visual-presentation"
                    }
                  ],
                  "related": [],
                  "url": "https://www.w3.org/WAI/WCAG21/Techniques/css/C19",
                  "passed": 24,
                  "warning": 0,
                  "failed": 2,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "This test target has a text-align css property not equal to justify."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "This test target has a text-align css property not equal to justify.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<style class=\"brz-style\">@media(min-width:991px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:991px) and (min-width:768px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:767px){.brz .brz-css-nkwmc{display:block;}}\n.brz .brz-css-mmmvq{padding:75px 0px 75px 0px;margin:0;}.brz .brz-css-mmmvq > .brz-bg{border:0px solid rgba(102, 115, 141, 0);border-radius:0;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-image{background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-image:after{content: \"\";background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-color{background-color:rgba(0, 0, 0, 0);background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-shape__top{background-size: 10 …",
                        "pointer": "html > body:nth-child(2) > style:nth-child(11)"
                      }
                    ],
                    "attributes": [
                      "text-align: justify"
                    ]
                  },
                  {
                    "verdict": "failed",
                    "description": "This test target has a text-align css property not equal to justify.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<style class=\"brz-style\">@media(min-width:991px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:991px) and (min-width:768px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:767px){.brz .brz-css-nkwmc{display:block;}}\n.brz .brz-css-mmmvq{padding:75px 0px 75px 0px;margin:0;}.brz .brz-css-mmmvq > .brz-bg{border:0px solid rgba(102, 115, 141, 0);border-radius:0;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-image{background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-image:after{content: \"\";background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-color{background-color:rgba(0, 0, 0, 0);background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-shape__top{background-size: 10 …",
                        "pointer": "html > body:nth-child(2) > style:nth-child(11)"
                      }
                    ],
                    "attributes": [
                      "text-align: justify"
                    ]
                  }
                ]
              },
              "QW-WCAG-T31": {
                "name": "Failure of Success Criterion 1.4.3, 1.4.6 and 1.4.8 due to specifying foreground colors without specifying background colors or vice versa",
                "code": "QW-WCAG-T31",
                "mapping": "F24",
                "description": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
                "metadata": {
                  "target": {
                    "element": "*",
                    "attributes": "text-decoration"
                  },
                  "success-criteria": [
                    {
                      "name": "1.4.3",
                      "level": "AA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/contrast-minimum"
                    },
                    {
                      "name": "1.4.6",
                      "level": "AAA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/contrast-enhanced"
                    },
                    {
                      "name": "1.4.8",
                      "level": "AAA",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/visual-presentation"
                    }
                  ],
                  "related": [
                    "C23",
                    "C25"
                  ],
                  "url": "https://www.w3.org/WAI/WCAG21/Techniques/failures/F24",
                  "passed": 35,
                  "warning": 0,
                  "failed": 23,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "The test target has a author defined color css property but not a background css property."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<noscript>\n<img height=\"1\" width=\"1\" style=\"display:none\" alt=\"fbpx\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" />\n</noscript>",
                        "pointer": "html > body:nth-child(2) > noscript:nth-child(5)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a href=\"https://joepatterson.com/\" style=\"\" class=\"link--external is-empty brz-cp-color8\" data-brz-link-type=\"external\">HOME</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color3\">THANK YOU!</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color3\">-Joe Patterson </span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color8\">STAND WITH JOE:</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color1\">Meet Joe Patterson</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<strong class=\"brz-cp-color8\">Endorse Joe</strong>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color8\">Paid for by Joe Patterson for Assembly 2024 FPPC ID</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color8 brz-pre-population-visible\"># </span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(2)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-cp-color8\">1456524</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(3)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<span class=\"brz-mm-sronly\">Close menu</span>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > div:nth-child(10) > a:nth-child(1) > span:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a href=\"https://joepatterson.com/\" style=\"\" class=\"link--external is-empty brz-cp-color8\" data-brz-link-type=\"external\">HOME</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a href=\"/about/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">MEET JOE</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a href=\"/news/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">NEWS</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a href=\"/ad5/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">AD5</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a href=\"/endorsements/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">ENDORSEMENTS</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a href=\"/yard-sign/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">YARD SIGNS</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "failed",
                    "description": "The test target has a author defined color css property but not a background css property.",
                    "resultCode": "F1",
                    "elements": [
                      {
                        "htmlCode": "<a href=\"/yard-sign/\" style=\"\" class=\"link--external brz-cp-color8\" data-brz-link-type=\"external\">VOLUNTEER</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(7) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              }
            }
          },
          "best-practices": {
            "type": "best-practices",
            "metadata": {
              "passed": 11,
              "warning": 1,
              "failed": 1,
              "inapplicable": 11
            },
            "assertions": {
              "QW-BP1": {
                "name": "Using h1-h6 to identify headings",
                "code": "QW-BP1",
                "mapping": "H42",
                "description": "It is recommended to use HTML and XHTML heading markup to provide semantic code for headings in the content",
                "metadata": {
                  "target": {
                    "element": [
                      "h1",
                      "h2",
                      "h3",
                      "h4",
                      "h5",
                      "h6"
                    ]
                  },
                  "success-criteria": [
                    {
                      "name": "1.3.1",
                      "level": "A",
                      "principle": "Perceivable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/info-and-relationships.html"
                    }
                  ],
                  "related": [
                    "H69",
                    "G141",
                    "F2",
                    "F43"
                  ],
                  "url": "https://www.w3.org/TR/WCAG20-TECHS/H42.html",
                  "passed": 0,
                  "warning": 0,
                  "failed": 1,
                  "inapplicable": 0,
                  "outcome": "failed",
                  "description": "This page doesn't use headings."
                },
                "results": [
                  {
                    "verdict": "failed",
                    "description": "This page doesn't use headings.",
                    "resultCode": "F1",
                    "elements": [],
                    "attributes": []
                  }
                ]
              },
              "QW-BP17": {
                "name": "Adding a link at the beginning of a block of repeated content to go to the end of the block",
                "code": "QW-BP17",
                "mapping": "G123",
                "description": "The objective of this technique is to provide a mechanism to bypass a block of material by skipping to the end of the block.",
                "metadata": {
                  "target": {
                    "element": "a",
                    "attributes": "href"
                  },
                  "success-criteria": [
                    {
                      "name": "2.4.1",
                      "level": "A",
                      "principle": "Operable",
                      "url": "https://www.w3.org/WAI/WCAG21/Understanding/bypass-blocks"
                    }
                  ],
                  "related": [
                    "G1",
                    "G124"
                  ],
                  "url": "https://www.w3.org/WAI/WCAG21/Techniques/general/G123",
                  "passed": 0,
                  "warning": 3,
                  "failed": 0,
                  "inapplicable": 0,
                  "outcome": "warning",
                  "description": "This link skips a content block."
                },
                "results": [
                  {
                    "verdict": "warning",
                    "description": "This link skips a content block.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-mm-navbar__title\" href=\"#mm-1\">Main Menu</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
                      },
                      {
                        "htmlCode": "<div id=\"mm-1\" class=\"brz-mm-panel brz-mm-panel_opened\">Main MenuHomeMeet JoeToggle submenuTVNewsAD5Issues</div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "This link skips a content block.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a class=\"brz-mm-btn brz-mm-btn_next brz-mm-listitem__btn\" href=\"#mm-2\">Toggle submenu</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > a:nth-child(2)"
                      },
                      {
                        "htmlCode": "<div id=\"mm-2\" class=\"brz-mm-panel brz-mm-hidden\" aria-hidden=\"true\">TV</div>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > div:nth-child(3)"
                      }
                    ],
                    "attributes": []
                  },
                  {
                    "verdict": "warning",
                    "description": "This link skips a content block.",
                    "resultCode": "W1",
                    "elements": [
                      {
                        "htmlCode": "<a href=\"#mm-0\">Close menu</a>",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24) > div:nth-child(10) > a:nth-child(1)"
                      },
                      {
                        "htmlCode": "<div class=\"brz-root__container brz-reset-all brz-mm-page brz-mm-slideout\" id=\"mm-0\">Main MenuHomeMeet JoeToggle submenuTVNewsAD5IssuesHomeMeet JoeTVNewsAD5Issues\n       HOMEDONATETHANK YOU! Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. -Joe Patterson JOE PATTERSONYour voice in the State Assembly.$5$10$25OTHERSTAND WITH JOE:$5$10$25$50$75OTHERJOIN THE TEAMSUBMIT    !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Mat …",
                        "pointer": "html > body:nth-child(2) > div:nth-child(24)"
                      }
                    ],
                    "attributes": []
                  }
                ]
              }
            }
          },
          "counter": {
            "type": "counter",
            "data": {
              "roles": {
                "link": 70,
                "document": 1,
                "img": 1,
                "none": 8,
                "navigation": 3,
                "list": 6,
                "listitem": 18,
                "region": 7,
                "presentation": 3,
                "graphics-document": 12,
                "form": 3,
                "textbox": 10,
                "button": 3,
                "separator": 1
              },
              "tags": {
                "html": 1,
                "head": 1,
                "meta": 24,
                "link": 25,
                "title": 1,
                "script": 33,
                "style": 6,
                "noscript": 2,
                "body": 1,
                "img": 4,
                "svg": 20,
                "defs": 8,
                "filter": 8,
                "fecolormatrix": 8,
                "fecomponenttransfer": 8,
                "fefuncr": 8,
                "fefuncg": 8,
                "fefuncb": 8,
                "fefunca": 8,
                "fecomposite": 8,
                "div": 258,
                "nav": 3,
                "a": 45,
                "span": 52,
                "ul": 6,
                "li": 18,
                "section": 7,
                "picture": 3,
                "g": 13,
                "path": 19,
                "p": 21,
                "br": 1,
                "strong": 2,
                "source": 2,
                "form": 3,
                "input": 10,
                "button": 3,
                "hr": 1,
                "footer": 1
              }
            }
          }
        },
        "success": true
      },
      "standardResult": {
        "totals": [
          18,
          83,
          80,
          34
        ],
        "instances": [
          {
            "ruleID": "QW-ACT-R63",
            "what": "This rule checks that each page has an element with a landmark semantic role starting with non-repeated content",
            "ordinalSeverity": 1,
            "tagName": "HTML",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html"
            },
            "excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>"
          },
          {
            "ruleID": "QW-ACT-R64",
            "what": "This rule checks that the non-repeated content contains a heading",
            "ordinalSeverity": 1,
            "tagName": "HTML",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html"
            },
            "excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>"
          },
          {
            "ruleID": "QW-ACT-R73",
            "what": "This rule checks that repeated blocks of content are collapsible.",
            "ordinalSeverity": 1,
            "tagName": "HTML",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html"
            },
            "excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>"
          },
          {
            "ruleID": "QW-ACT-R74",
            "what": "This rule checks that there is an instrument to move focus to non-repeated content in the page.",
            "ordinalSeverity": 1,
            "tagName": "HTML",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html"
            },
            "excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>"
          },
          {
            "ruleID": "QW-ACT-R12",
            "what": "This rule checks that each link has an accessible name.",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>"
          },
          {
            "ruleID": "QW-ACT-R12",
            "what": "This rule checks that each link has an accessible name.",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>"
          },
          {
            "ruleID": "QW-ACT-R12",
            "what": "This rule checks that each link has an accessible name.",
            "ordinalSeverity": 3,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>"
          },
          {
            "ruleID": "QW-ACT-R18",
            "what": "This rule checks that all id attribute values on a single page are unique.",
            "ordinalSeverity": 3,
            "tagName": "SCRIPT",
            "id": "www-widgetapi-script",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > script:nth-child(25)"
            },
            "excerpt": "<script type=\"text/javascript\" id=\"www-widgetapi-script\" src=\"https://www.youtube.com/s/player/6ed0d907/www-widgetapi.vflset/www-widgetapi.js\" async=\"\"></script>"
          },
          {
            "ruleID": "QW-ACT-R18",
            "what": "This rule checks that all id attribute values on a single page are unique.",
            "ordinalSeverity": 3,
            "tagName": "SCRIPT",
            "id": "www-widgetapi-script",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > script:nth-child(27)"
            },
            "excerpt": "<script type=\"text/javascript\" id=\"www-widgetapi-script\" src=\"https://www.youtube.com/s/player/6ed0d907/www-widgetapi.vflset/www-widgetapi.js\" async=\"\"></script>"
          },
          {
            "ruleID": "QW-ACT-R18",
            "what": "This rule checks that all id attribute values on a single page are unique.",
            "ordinalSeverity": 3,
            "tagName": "G",
            "id": "close-popup",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1)"
            },
            "excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\"> </g>"
          },
          {
            "ruleID": "QW-ACT-R18",
            "what": "This rule checks that all id attribute values on a single page are unique.",
            "ordinalSeverity": 3,
            "tagName": "G",
            "id": "close-popup",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1)"
            },
            "excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\"> </g>"
          },
          {
            "ruleID": "QW-ACT-R18",
            "what": "This rule checks that all id attribute values on a single page are unique.",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(1)"
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
          },
          {
            "ruleID": "QW-ACT-R18",
            "what": "This rule checks that all id attribute values on a single page are unique.",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(2)"
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
          },
          {
            "ruleID": "QW-ACT-R18",
            "what": "This rule checks that all id attribute values on a single page are unique.",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(1)"
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
          },
          {
            "ruleID": "QW-ACT-R18",
            "what": "This rule checks that all id attribute values on a single page are unique.",
            "ordinalSeverity": 3,
            "tagName": "PATH",
            "id": "Line-2",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(2)"
            },
            "excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">Home</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">Meet Joe</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">News</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">AD5</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">Issues</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">DONATE</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">$5</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">$10</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">$25</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">$50</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">$75</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">OTHER</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s ... [0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email *\" data-placeholder=\"Email *\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "BUTTON",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1)"
            },
            "excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj\" data-custom-id=\"nxouluvbretczsumlwfttgzfltqnntvlwvaf\">SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()} ... ggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this.start=t);var n=t-thi …"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\">Learn More</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@ ... \\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email*\" data-placeholder=\"Email*\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "BUTTON",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > button:nth-child(1)"
            },
            "excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-dyvgx\" data-custom-id=\"pctxnochcdlwubleyhhicvdleifnqiyrttuh\">Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.sta ... AnimationFrame(t.triggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this. …"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">Home</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">Meet Joe</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">News</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">AD5</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">Issues</a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\ ... [0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email Updates\" data-placeholder=\"Email Updates\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "BUTTON",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1)"
            },
            "excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-rplcf\" data-custom-id=\"urngpgulgkggkfoivjalbjunpabjeeujtqmh\">SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=nul ... ionFrame(t.triggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this.start= …"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>"
          },
          {
            "ruleID": "QW-ACT-R62",
            "what": "This rule checks that each element in sequential focus order has some visible focus indication.",
            "ordinalSeverity": 1,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>"
          },
          {
            "ruleID": "QW-ACT-R41",
            "what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R41",
            "what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R41",
            "what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s ... [0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email *\" data-placeholder=\"Email *\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
          },
          {
            "ruleID": "QW-ACT-R41",
            "what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R41",
            "what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R41",
            "what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R41",
            "what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R41",
            "what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\.,;:\\s@ ... \\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email*\" data-placeholder=\"Email*\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
          },
          {
            "ruleID": "QW-ACT-R41",
            "what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
          },
          {
            "ruleID": "QW-ACT-R41",
            "what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
            "ordinalSeverity": 1,
            "tagName": "INPUT",
            "id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
            },
            "excerpt": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@&quot;]+(\\.[^<>()\\[\\]\\\\ ... [0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email Updates\" data-placeholder=\"Email Updates\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
          },
          {
            "ruleID": "QW-ACT-R17",
            "what": "This rule checks that each image that is not marked as decorative, has an accessible name.",
            "ordinalSeverity": 3,
            "tagName": "IMG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > img:nth-child(1)"
            },
            "excerpt": "<img src=\"http://ib.adnxs.com/seg?add=30067132&amp;t=2\" width=\"1\" height=\"1\">"
          },
          {
            "ruleID": "QW-ACT-R37",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Home</span>"
          },
          {
            "ruleID": "QW-ACT-R37",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Meet Joe</span>"
          },
          {
            "ruleID": "QW-ACT-R37",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">News</span>"
          },
          {
            "ruleID": "QW-ACT-R37",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">AD5</span>"
          },
          {
            "ruleID": "QW-ACT-R37",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Issues</span>"
          },
          {
            "ruleID": "QW-ACT-R37",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Home</span>"
          },
          {
            "ruleID": "QW-ACT-R37",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Meet Joe</span>"
          },
          {
            "ruleID": "QW-ACT-R37",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">News</span>"
          },
          {
            "ruleID": "QW-ACT-R37",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">AD5</span>"
          },
          {
            "ruleID": "QW-ACT-R37",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Issues</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Home</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Meet Joe</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">News</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">AD5</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Issues</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Home</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Meet Joe</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">News</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">AD5</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Issues</span>"
          },
          {
            "ruleID": "QW-ACT-R76",
            "what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
            "ordinalSeverity": 3,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>"
          },
          {
            "ruleID": "QW-ACT-R75",
            "what": "This rule checks that each page has a mechanism to bypass repeated blocks of content.",
            "ordinalSeverity": 1,
            "tagName": "HTML",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html"
            },
            "excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body>Joe Patterson {\"@context\":\"https:\\/\\/schema.org\",\"@graph\":[{\"@type\":\"WebSite\",\"@id\":\"https:\\/\\/joepatterson.com\\/#websit ... e\":\"https:\\/\\/joepatterson.com\\/?s={search_term_string}\"},\"query-input\":\"required name=search_term_string\"}},{\"@type\":\"Organization\",\"@id\":\"https:\\/\\/joepatterson.com\\/#organization\",\"name\":\"Joe Pat …"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Home</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Meet Joe</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">News</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">AD5</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Issues</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(2)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">DONATE</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-cp-color3\">THANK YOU!</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-cp-color3\">-Joe Patterson </span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "STRONG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
            },
            "excerpt": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-cp-color8\">STAND WITH JOE:</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">$5</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">$10</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">$25</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">$50</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">$75</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">OTHER</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-cp-color1\">Meet Joe Patterson</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four c ... n. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">Learn More</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "STRONG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
            },
            "excerpt": "<strong class=\"brz-cp-color8\">Endorse Joe</strong>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > button:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">Endorse Joe!</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Home</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Meet Joe</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">News</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">AD5</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span\">Issues</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-cp-color8\">Paid for by Joe Patterson for Assembly 2024 FPPC ID</span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(2)"
            },
            "excerpt": "<span class=\"brz-cp-color8 brz-pre-population-visible\"># </span>"
          },
          {
            "ruleID": "QW-ACT-R40",
            "what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
            "ordinalSeverity": 1,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(3)"
            },
            "excerpt": "<span class=\"brz-cp-color8\">1456524</span>"
          },
          {
            "ruleID": "QW-WCAG-T23",
            "what": "The objective of this technique is to provide a mechanism to bypass blocks of material that are repeated on multiple Web pages by skipping directly to the main content of the Web page.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>"
          },
          {
            "ruleID": "QW-WCAG-T21",
            "what": "This technique checks the text alternative of images which are the only content of a link",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(2)"
            },
            "excerpt": "<link rel=\"profile\" href=\"http://gmpg.org/xfn/11\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(3)"
            },
            "excerpt": "<link rel=\"pingback\" href=\"https://joepatterson.com/xmlrpc.php\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(31)"
            },
            "excerpt": "<link rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "astra-theme-css-css",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(36)"
            },
            "excerpt": "<link rel=\"stylesheet\" id=\"astra-theme-css-css\" href=\"https://joepatterson.com/wp-content/themes/astra/assets/css/minified/main.min.css?ver=3.7.10\" media=\"all\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "wp-block-library-css",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(38)"
            },
            "excerpt": "<link rel=\"stylesheet\" id=\"wp-block-library-css\" href=\"https://joepatterson.com/wp-includes/css/dist/block-library/style.min.css?ver=6.2.2\" media=\"all\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "brizy-asset-google-10-css",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(40)"
            },
            "excerpt": "<link rel=\"stylesheet\" id=\"brizy-asset-google-10-css\" class=\"brz-link brz-link-google\" type=\"text/css\" href=\"https://fonts.googleapis.com/css?family=Overpass%3A100%2C100italic%2C200%2C200italic%2C300% ... c%2C300%2C300italic%2Cregular%2Citalic%2C700%2C700italic%2C900%2C900italic%7CRed+Hat+Text%3Aregular%2Citalic%2C500%2C500italic%2C700%2C700italic&amp;subset=arabic%2Cbengali%2Ccyrillic%2Ccyrillic-ext …"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "brizy-asset-group-1-20-css",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(41)"
            },
            "excerpt": "<link rel=\"stylesheet\" id=\"brizy-asset-group-1-20-css\" class=\"brz-link brz-link-preview-lib\" data-group=\"group-1\" href=\"https://joepatterson.com/wp-content/plugins/brizy/public/editor-build/232-wp/editor/css/group-1.css?ver=2.3.35\" media=\"all\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "brizy-asset-group-2-21-css",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(42)"
            },
            "excerpt": "<link rel=\"stylesheet\" id=\"brizy-asset-group-2-21-css\" class=\"brz-link brz-link-preview-lib-pro\" data-group=\"group-2\" href=\"https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/group-2-pro.css?ver=2.3.28\" media=\"all\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "brizy-asset-main-30-css",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(43)"
            },
            "excerpt": "<link rel=\"stylesheet\" id=\"brizy-asset-main-30-css\" class=\"brz-link brz-link-preview-pro\" href=\"https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/preview.pro.css?ver=2.3.28\" media=\"all\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(48)"
            },
            "excerpt": "<link rel=\"https://api.w.org/\" href=\"https://joepatterson.com/wp-json/\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(50)"
            },
            "excerpt": "<link rel=\"EditURI\" type=\"application/rsd+xml\" title=\"RSD\" href=\"https://joepatterson.com/xmlrpc.php?rsd\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(51)"
            },
            "excerpt": "<link rel=\"wlwmanifest\" type=\"application/wlwmanifest+xml\" href=\"https://joepatterson.com/wp-includes/wlwmanifest.xml\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > head:nth-child(1) > link:nth-child(53)"
            },
            "excerpt": "<link rel=\"shortlink\" href=\"https://joepatterson.com/\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "ordinalSeverity": 0,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > link:nth-child(7)"
            },
            "excerpt": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//ajax.googleapis.com\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "ordinalSeverity": 0,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > link:nth-child(8)"
            },
            "excerpt": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "ordinalSeverity": 0,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > link:nth-child(9)"
            },
            "excerpt": "<link class=\"brz-link brz-link-google-preconnect\" rel=\"preconnect\" href=\"https://fonts.gstatic.com/\" crossorigin=\"\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "ordinalSeverity": 0,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > link:nth-child(12)"
            },
            "excerpt": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "ordinalSeverity": 0,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > link:nth-child(13)"
            },
            "excerpt": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\">"
          },
          {
            "ruleID": "QW-WCAG-T15",
            "what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
            "ordinalSeverity": 0,
            "tagName": "LINK",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > link:nth-child(14)"
            },
            "excerpt": "<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\">"
          },
          {
            "ruleID": "QW-WCAG-T32",
            "what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
            "ordinalSeverity": 0,
            "tagName": "UL",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2)"
            },
            "excerpt": "<ul class=\"brz-menu__ul brz-mm-listview\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-mm-menu__item brz-mm-menu__item-empty brz-mm-menu__item--current brz-mm-listitem\" data ... l > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(1) > a:nth-child(1)\" _cssrules=\"true\"><span class=\"brz-span\" _sele …"
          },
          {
            "ruleID": "QW-WCAG-T32",
            "what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
            "ordinalSeverity": 0,
            "tagName": "UL",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > div:nth-child(3) > ul:nth-child(1)"
            },
            "excerpt": "<ul class=\"brz-mm-menu__sub-menu brz-menu__ul--has-dropdown brz-mm-listview\"><li class=\"brz-mm-menu__item brz-mm-menu__item-empty brz-mm-listitem\" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"> ... -child(2) > li:nth-child(2) > div:nth-child(3) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)\" _cssrules=\"true\"><span class=\"brz-span\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > …"
          },
          {
            "ruleID": "QW-WCAG-T32",
            "what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
            "ordinalSeverity": 0,
            "tagName": "UL",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1)"
            },
            "excerpt": "<ul class=\"brz-menu__ul\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-menu__item brz-menu__item--current\" data-menu-item-id=\"b80377d0ea164df79e92847fe9d7db93\"><a class=\"brz ... div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-c …"
          },
          {
            "ruleID": "QW-WCAG-T32",
            "what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
            "ordinalSeverity": 0,
            "tagName": "UL",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > ul:nth-child(2)"
            },
            "excerpt": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22% ... \" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"e …"
          },
          {
            "ruleID": "QW-WCAG-T32",
            "what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
            "ordinalSeverity": 0,
            "tagName": "UL",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1)"
            },
            "excerpt": "<ul class=\"brz-menu__ul\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-menu__item brz-menu__item--current\" data-menu-item-id=\"b80377d0ea164df79e92847fe9d7db93\"><a class=\"brz ... iv:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child …"
          },
          {
            "ruleID": "QW-WCAG-T32",
            "what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
            "ordinalSeverity": 0,
            "tagName": "UL",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > ul:nth-child(2)"
            },
            "excerpt": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22% ... opper-placement=\"top-start\"><li class=\"brz-menu__item\" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://jo …"
          },
          {
            "ruleID": "QW-WCAG-T19",
            "what": "The objective of this technique is to provide a mechanism that allows users to explicitly request changes of context. The intended use of a submit button is to generate an HTTP request that submits data entered in a form, so it is an appropriate control to use for causing a change of context.",
            "ordinalSeverity": 2,
            "tagName": "FORM",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
            },
            "excerpt": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"dskyguesfdwsuhockwwasaportijqvjngws ...  e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationF …"
          },
          {
            "ruleID": "QW-WCAG-T19",
            "what": "The objective of this technique is to provide a mechanism that allows users to explicitly request changes of context. The intended use of a submit button is to generate an HTTP request that submits data entered in a form, so it is an appropriate control to use for causing a change of context.",
            "ordinalSeverity": 2,
            "tagName": "FORM",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
            },
            "excerpt": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"fbtlofiblnoutrunfzizbsdvloekmnvpisx ... ationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype …"
          },
          {
            "ruleID": "QW-WCAG-T19",
            "what": "The objective of this technique is to provide a mechanism that allows users to explicitly request changes of context. The intended use of a submit button is to generate an HTTP request that submits data entered in a form, so it is an appropriate control to use for causing a change of context.",
            "ordinalSeverity": 2,
            "tagName": "FORM",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
            },
            "excerpt": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"fonhcxfbmwbbacpwvgmiprkqrpdqrdbvdnr ... getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationFrame(t.trigger …"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-icon css-3z2g66\"> </span>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-pzxzi\" data-uniq-id=\"ktmas\" data-generated-css=\"brz-css-xvlfv\"></p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1)"
            },
            "excerpt": "<svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\"> </svg>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-zctmh\" data-uniq-id=\"hlkbv\" data-generated-css=\"brz-css-yeiqu\">HOME</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">DONATE</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > svg:nth-child(1)"
            },
            "excerpt": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-css-oheuj\" data-type=\"glyph\" data-name=\"tail-right\"></svg>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-icon css-1v9psv1\"></span>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\">THANK YOU!</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-vtphm\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"> </p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2)"
            },
            "excerpt": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3)"
            },
            "excerpt": "<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\">-Joe Patterson </p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-icon css-1cnr1ql\"></span>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-lkuyo\" data-generated-css=\"brz-css-kokqw\" data-uniq-id=\"hpxfi\">JOE PATTERSON</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-mkkan\" data-uniq-id=\"lwuac\" data-generated-css=\"brz-css-erjeq\">Your voice in the State Assembly.</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdggtybzbtscl\">$5</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufznyxypipympv\">$10</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurwjvjsywyumae\">$25</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-cbllz\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yemcvnewgngfymiotxewwyjzajhaeldnceah\">OTHER</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p data-uniq-id=\"qctya\" data-generated-css=\"brz-css-oooyn\" class=\"brz-css-yhukw\">STAND WITH JOE:</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">$5</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">$10</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">$25</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">$50</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">$75</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">OTHER</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p data-uniq-id=\"hwwdz\" data-generated-css=\"brz-css-owosm\" class=\"brz-css-dbkfe\">JOIN THE TEAM</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-gjenq\"></div>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-sqjjw\"></div>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk\"></div>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-solsx\"></div>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-xnabq\"></div>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\">Meet Joe Patterson</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four c ... n. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "A",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
            },
            "excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\">Learn More</a>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-bklfk\" data-uniq-id=\"qxpfh\" data-generated-css=\"brz-css-owucl\">Endorse Joe</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-ilwyl\"></div>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-odtpn\"></div>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-fyenv\"></div>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-cbrxq\"></div>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "DIV",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
            },
            "excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-ztibp brz-css-liimk brz-css-vgqwm\"></div>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-icon css-1yqt0eo\"></span>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "SPAN",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
            },
            "excerpt": "<span class=\"brz-span brz-icon css-1ldonqd\"></span>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "SVG",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1)"
            },
            "excerpt": "<svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\"> </svg>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-rjztm\" data-uniq-id=\"hlkbv\" data-generated-css=\"brz-css-yeiqu\">HOME</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-xquao\" data-generated-css=\"brz-css-mqzvf\" data-uniq-id=\"fmuwc\">MEET JOE</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-yjyph\" data-uniq-id=\"lejsp\" data-generated-css=\"brz-css-fumnn\">NEWS</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-bwxye\" data-generated-css=\"brz-css-tujgm\" data-uniq-id=\"ulmaa\">AD5</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-wwpav\" data-uniq-id=\"qtxdk\" data-generated-css=\"brz-css-hhgpv\">ENDORSEMENTS</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-tbnau\" data-uniq-id=\"knloz\" data-generated-css=\"brz-css-opatl\">YARD SIGNS</p>"
          },
          {
            "ruleID": "QW-WCAG-T28",
            "what": "This technique checks that all font-size attribute uses percent, em or names.",
            "ordinalSeverity": 2,
            "tagName": "P",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(7) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
            },
            "excerpt": "<p class=\"brz-css-dzpeg\" data-generated-css=\"brz-css-nsqiu\" data-uniq-id=\"dmvlt\">VOLUNTEER</p>"
          },
          {
            "ruleID": "QW-WCAG-T29",
            "what": "This technique describes how to align blocks of text either left or right by setting the CSS text-align property.",
            "ordinalSeverity": 2,
            "tagName": "STYLE",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > style:nth-child(11)"
            },
            "excerpt": "<style class=\"brz-style\">@media(min-width:991px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:991px) and (min-width:768px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:767px){.brz .brz ... \";background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-color{background-color:rgba(0, 0, 0, 0);background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-shape__top{background-size: 10 …"
          },
          {
            "ruleID": "QW-WCAG-T29",
            "what": "This technique describes how to align blocks of text either left or right by setting the CSS text-align property.",
            "ordinalSeverity": 2,
            "tagName": "STYLE",
            "id": "",
            "location": {
              "doc": "dom",
              "type": "selector",
              "spec": "html > body:nth-child(2) > style:nth-child(11)"
            },
            "excerpt": "<style class=\"brz-style\">@media(min-width:991px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:991px) and (min-width:768px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:767px){.brz .brz ... \";background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-color{background-color:rgba(0, 0, 0, 0);background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-shape__top{background-size: 10 …"
          },
          {
            "ruleID": "QW-WCAG-T31",
            "what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
            "ordinalSeverity": 2,
            "ta