Accessibility digest
| Page | Candidate Joe Patterson (R) |
|---|---|
| URL | https://joepatterson.com/ |
| Requester | pool@jpdev.pro |
| Test date | 2023/06/18 |
| Score | 1696 |
| Tested by | Testaro, procedure ts27 |
| Scored by | Testilo, procedure tsp27 |
| Digested by | Testilo, procedure tdp27 |
Introduction
This is a digest of results from a battery of web accessibility tests.
Ten different tools (Alfa, Axe, Continuum, Equal Access, HTML CodeSniffer, Nu Html Checker, QualWeb, Tenon, Testaro, and WAVE) tested the web page of Candidate Joe Patterson (R) at https://joepatterson.com/ to check its compliance with various rules. There were a total of about 1350 rules, classified into about 250 accessibility issues.
The results were interpreted to yield an aggregate score of 1696, where 0 would be perfect
.
Total score
The total score is the sum of five components.
| Component | Score | Description |
|---|---|---|
| total | 1696 | Sum of the component scores |
| issue | 1456 | Severity and number of reported defects |
| tool | 219 | Tool-by-tool defect ratings |
| prevention | 0 | Failed attempts by tools to test the page |
| log | 21 | Browser warnings about the page |
| latency | 0 | Abnormal delay in page responses |
Issue scores
The score of an issue depends on the severity (user impact and certainty) of the issue and on how many instances were reported (by one or more tools).
| Issue | Score |
|---|---|
| focusIndication | 136 |
| fontSizeAbsolute | 100 |
| fatalError | 100 |
| colorMissing | 92 |
| duplicateID | 88 |
| linkIndication | 88 |
| textContrastAA | 76 |
| targetSize | 54 |
| slashParseRisk | 46 |
| contentBeyondLandmarks | 40 |
| controlNoText | 40 |
| inputNoText | 40 |
| errorReferenceBad | 40 |
| linkForcesNewWindow | 39 |
| overflowHiddenRisk | 34 |
| inputOnlyPlaceholder | 30 |
| linkElementBad | 24 |
| svgImageNoText | 20 |
| labelClash | 20 |
| siteNavigation | 19 |
| elementClosure | 18 |
| pseudoHeadingRisk | 17 |
| linkNoText | 16 |
| hiddenContentRisk | 13 |
| linkWindowSurpriseRisk | 13 |
| allCaps | 13 |
| imageNoText | 12 |
| contrastAAA | 12 |
| obsolete | 12 |
| metaBad | 12 |
| cssInvalid | 12 |
| pseudoNavList | 12 |
| zIndexNotZero | 12 |
| linkTextsSame | 10 |
| repeatedContentRisk | 9 |
| submitButton | 9 |
| leadingInsufficient | 8 |
| parentBad | 8 |
| leadingClipsText | 8 |
| hoverSurprise | 8 |
| navConfusion | 6 |
| navNoText | 6 |
| parseError | 6 |
| skipRepeatedContent | 6 |
| fontSmall | 6 |
| focusableOperable | 6 |
| typeRedundant | 5 |
| justification | 4 |
| internalLinkBroken | 4 |
| textRotated | 4 |
| inconsistentStyles | 4 |
| linkPair | 4 |
| noHeading | 3 |
| landmarkConfusion | 3 |
| h1Missing | 3 |
| decorativeImageRisk | 3 |
| scrollRisk | 3 |
| roleBad | 3 |
| horizontalScrolling | 3 |
| linkVague | 3 |
| autocompleteNone | 3 |
| mainNone | 2 |
| justificationRisk | 2 |
| noScriptRisk | 2 |
| contrastRisk | 1 |
| visibleBulk | 1 |
Itemized issues
The reported rule violations are itemized below, issue by issue. Additional details can be inspected in the complete report at the end of this page.
Issue focusIndication
WCAG: 2.4.7
Score: 136
Complaints by alfa
Rule r65
r65Description: Element in the sequential focus order has no visible focus
Count of instances: 34
Complaint specifics
- Element in sequential focus order has visible focus
Complaints by qualWeb
Rule QW-ACT-R62
QW-ACT-R62Description: Element in the sequential focus order has no visible focus
Count of instances: 34
Complaint specifics
- This rule checks that each element in sequential focus order has some visible focus indication.
Complaints by testaro
Rule focInd
focIndDescription: Focused element displays a nonstandard or no focus indicator
Count of instances: 34
Complaint specifics
- A element has no focus indicator
- INPUT element has no focus indicator
- BUTTON element has no focus indicator
Issue fontSizeAbsolute
WCAG: 1.4.4
Score: 100
Complaints by alfa
Rule r74
r74Description: Paragraph text has an absolute font size
Count of instances: 5
Complaint specifics
- Paragraphs of text do not have font sizes defined in absolute units
Complaints by qualWeb
Rule QW-WCAG-T28
QW-WCAG-T28Description: Percent, em, or name is used for a font size
Count of instances: 50
Complaint specifics
- This technique checks that all font-size attribute uses percent, em or names.
Issue fatalError
WCAG: 4.1
Score: 100
Complaints by nuVal
Rule Cannot recover after last error. Any further errors will be ignored.
Cannot recover after last error. Any further errors will be ignored.Description: Testing was interrupted by a fatal error
Count of instances: 2
Complaint specifics
- Cannot recover after last error. Any further errors will be ignored.
Issue colorMissing
WCAG: 1.4.3
Score: 92
Complaints by qualWeb
Rule QW-WCAG-T31
QW-WCAG-T31Description: Foreground or background color is specified but not both
Count of instances: 23
Complaint specifics
- Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.
Issue duplicateID
WCAG: 4.1.1
Score: 88
Complaints by alfa
Rule r3
r3Description: Element id attribute value is not unique
Count of instances: 6
Complaint specifics
- id attributes have a unique value
Complaints by axe
Rule duplicate-id
duplicate-idDescription: id attribute value is not unique
Count of instances: 2
Complaint specifics
- id attribute value must be unique; Document has multiple static elements with the same id attribute: close-popup
- id attribute value must be unique; Document has multiple static elements with the same id attribute: Line-2
Complaints by continuum
Rule 94
94Description: Element contains an id attribute set to a value that is not unique in the DOM
Count of instances: 6
Complaint specifics
- This g has an id attribute of 'close-popup', which is not unique in the same DOM
- This path has an id attribute of 'Line-2', which is not unique in the same DOM
Complaints by htmlcs
Rule AAA.4_1_1.F77
AAA.4_1_1.F77Description: Duplicate id attribute value
Count of instances: 3
Complaint specifics
- Duplicate id attribute value "close-popup" found on the web page.
- Duplicate id attribute value "Line-2" found on the web page.
Complaints by ibm
Rule element_id_unique
element_id_uniqueDescription: Element has an id attribute value that is already in use
Count of instances: 22
Complaint specifics
- The <a> element has the id "" that is empty
- The <div> element has the id "" that is empty
Complaints by qualWeb
Rule QW-ACT-R18
QW-ACT-R18Description: id attribute value is not unique
Count of instances: 8
Complaint specifics
- This rule checks that all id attribute values on a single page are unique.
Issue linkIndication
WCAG: 1.3.3
Score: 88
Complaints by testaro
Rule linkUl
linkUlDescription: Non-underlined adjacent links
Count of instances: 44
Complaint specifics
- Link is inline but has no underline
Issue textContrastAA
WCAG: 1.4.3
Score: 76
Complaints by alfa
Rule r69
r69Description: Text outside widget has subminimum contrast
Count of instances: 5
Complaint specifics
- Text outside widget has minimum contrast
Complaints by axe
Rule color-contrast
color-contrastDescription: Element has insufficient color contrast
Count of instances: 11
Complaint specifics
- Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined due to a background gradient
- Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it partially overlaps other elements
- Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element
Complaints by htmlcs
Rule AAA.1_4_6.G18.Fail
AAA.1_4_6.G18.FailDescription: Contrast between the text and its background is less than 4.5:1
Count of instances: 5
Complaint specifics
- This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #767676.
Complaints by qualWeb
Rule QW-ACT-R37
QW-ACT-R37Description: Text has less than the minimum contrast
Count of instances: 10
Complaint specifics
- This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.
Complaints by wave
Rule contrast
contrastDescription: Very low contrast
Count of instances: 19
Complaint specifics
- Very low contrast
Issue targetSize
WCAG: 2.5.5
Score: 54
Complaints by tenon
Rule 152
152Description: Actionable element is smaller than the minimum required size
Count of instances: 18
Complaint specifics
- This actionable element is smaller than the minimum required size.
Issue slashParseRisk
WCAG: 4.1
Score: 46
Complaints by nuVal
Rule Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.
Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.Description: Void element has a useless trailing slash.
Count of instances: 46
Complaint specifics
- Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.
Issue contentBeyondLandmarks
WCAG: 1.3.6
Score: 40
Complaints by alfa
Rule r57
r57Description: Perceivable text content is not included in any landmark
Count of instances: 20
Complaint specifics
- Perceivable text content is included in a landmark
Complaints by axe
Rule region
regionDescription: Some page content is not contained by landmarks
Count of instances: 20
Complaint specifics
- All page content should be contained by landmarks; Some page content is not contained by landmarks
Complaints by ibm
Rule aria_content_in_landmark
aria_content_in_landmarkDescription: Content is not within a landmark element
Count of instances: 16
Complaint specifics
- Content is not within a landmark element
Issue controlNoText
WCAG: 4.1.2
Score: 40
Complaints by htmlcs
Rule AAA.1_3_1.F68
AAA.1_3_1.F68Description: Form control has no label
Count of instances: 7
Complaint specifics
- This form field should be labelled in some way. Use the label element (either with a "for" attribute or wrapped around the form field), or "title", "aria-label" or "aria-labelledby" attributes as appropriate.
Complaints by wave
Rule label_missing
label_missingDescription: form element has no label
Count of instances: 10
Complaint specifics
- Missing form label
Issue inputNoText
WCAG: 4.1.2
Score: 40
Complaints by htmlcs
Rule AAA.4_1_2.H91.InputEmail.Name
AAA.4_1_2.H91.InputEmail.NameDescription: Email input has no accessible name
Count of instances: 3
Complaint specifics
- This emailinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.
Rule AAA.4_1_2.H91.InputText.Name
Description: Text input has no accessible name
Count of instances: 7
Complaint specifics
- This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.
Issue errorReferenceBad
WCAG: 3.3.1
Score: 40
Complaints by qualWeb
Rule QW-ACT-R41
QW-ACT-R41Description: Error message describes no invalid form field value
Count of instances: 10
Complaint specifics
- This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.
Issue linkForcesNewWindow
WCAG: 3.2.5
Score: 39
Complaints by tenon
Rule 218
218Description: Link opens in a new window without user control
Count of instances: 13
Complaint specifics
- This link opens in a new window without user control.
Issue overflowHiddenRisk
WCAG: 1.4.4
Score: 34
Complaints by qualWeb
Rule QW-ACT-R40
QW-ACT-R40Description: Zoomed text node may be clipped by a CSS overflow declaration
Count of instances: 34
Complaint specifics
- This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.
Issue inputOnlyPlaceholder
WCAG: 4.1.2
Score: 30
Complaints by continuum
Rule 863
863Description: input has an accessible name that depends on a placeholder
Count of instances: 10
Complaint specifics
- This input should not rely on text in the placeholder attribute for an accessible name
Issue linkElementBad
WCAG: 1.3.1
Score: 24
Complaints by htmlcs
Rule AAA.2_4_8.H59.1
AAA.2_4_8.H59.1Description: link element is not in the document head
Count of instances: 6
Complaint specifics
- Link elements can only be located in the head section of the document.
Complaints by nuVal
Rule A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.
A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.Description: link element with a body ancestor has no itemprop or valid rel attribute
Count of instances: 3
Complaint specifics
- A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.
Issue svgImageNoText
WCAG: 1.1.1
Score: 20
Complaints by continuum
Rule 123
123Description: svg element has no machanism allowing an accessible name to be calculated
Count of instances: 5
Complaint specifics
- This svg element does not have a mechanism that allows an accessible name value to be calculated
Issue labelClash
WCAG: 1.3.1
Score: 20
Complaints by testaro
Rule labClash
labClashDescription: Incompatible label types
Count of instances: 10
Complaint specifics
- Element INPUT is unlabeled
Issue siteNavigation
WCAG: 2.4
Score: 19
Complaints by qualWeb
Rule QW-WCAG-T15
QW-WCAG-T15Description: link element and navigation tools not used
Count of instances: 19
Complaint specifics
- The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.
Issue elementClosure
WCAG: 4.1.1
Score: 18
Complaints by nuVal
Rule ^Stray end tag .+$
^Stray end tag .+$Description: Invalid closing tag
Count of instances: 4
Complaint specifics
- Stray end tag noscript.
- Stray end tag head.
Rule ^Start tag .+ seen but an element of the same type was already open.*$
Description: Element is invalidly a descendant of another such element
Count of instances: 2
Complaint specifics
- Start tag body seen but an element of the same type was already open.
Issue pseudoHeadingRisk
WCAG: 1.3.1
Score: 17
Complaints by htmlcs
Rule AAA.1_3_1.H42
AAA.1_3_1.H42Description: Heading coding is not used but the element may be intended as a heading
Count of instances: 2
Complaint specifics
- Heading markup should be used if this content is intended as a heading.
Complaints by wave
Rule heading_possible
heading_possibleDescription: Possible heading
Count of instances: 17
Complaint specifics
- Possible heading
Issue linkNoText
WCAG: 2.4.4
Score: 16
Complaints by alfa
Rule r11
r11Description: Link has no accessible name
Count of instances: 3
Complaint specifics
- Links have an accessible name
Complaints by axe
Rule link-name
link-nameDescription: Link has no discernible text
Count of instances: 3
Complaint specifics
- Links must have discernible text; Element does not have text that is visible to screen readers; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute
Complaints by continuum
Rule 237
237Description: a element has no machanism allowing an accessible name value to be calculated
Count of instances: 3
Complaint specifics
- This A element does not have a mechanism that allows an accessible name value to be calculated
Complaints by htmlcs
Rule AAA.4_1_2.H91.A.NoContent
AAA.4_1_2.H91.A.NoContentDescription: Link has an href attribute but no text
Count of instances: 3
Complaint specifics
- Anchor element found with a valid href attribute, but no link content has been supplied.
Complaints by ibm
Rule a_text_purpose
a_text_purposeDescription: Hyperlink has no link text, label, or image with a text alternative
Count of instances: 4
Complaint specifics
- Hyperlink has no link text, label or image with a text alternative
Complaints by qualWeb
Rule QW-ACT-R12
QW-ACT-R12Description: Link has no accessible name
Count of instances: 3
Complaint specifics
- This rule checks that each link has an accessible name.
Rule QW-WCAG-T21
Description: Accessible name is not provided for an image which is the only content in a link
Count of instances: 1
Complaint specifics
- This technique checks the text alternative of images which are the only content of a link
Complaints by tenon
Rule 57
57Description: Link has no text inside it
Count of instances: 4
Complaint specifics
- This link has no text inside it.
Complaints by wave
Rule alt_link_missing
alt_link_missingDescription: Linked image has no text alternative
Count of instances: 1
Complaint specifics
- Linked image missing alternative text
Rule link_empty
Description: Link contains no text
Count of instances: 3
Complaint specifics
- Empty link
Issue hiddenContentRisk
WCAG: 4.1
Score: 13
Complaints by axe
Rule hidden-content
hidden-contentDescription: Some content is hidden and therefore may not be testable for accessibility
Count of instances: 13
Complaint specifics
- Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.
Issue linkWindowSurpriseRisk
WCAG: 3.2.5
Score: 13
Complaints by htmlcs
Rule AAA.3_2_5.H83.3
AAA.3_2_5.H83.3Description: Link text may fail to indicate that the link will open in a new window
Count of instances: 13
Complaint specifics
- Check that this link's link text contains information indicating that the link will open in a new window.
Issue allCaps
WCAG: 3.1.5
Score: 13
Complaints by tenon
Rule 153
153Description: Long string of text is in all caps
Count of instances: 13
Complaint specifics
- This long string of text is in all caps.
Issue imageNoText
WCAG: 1.1.1
Score: 12
Complaints by alfa
Rule r2
r2Description: Image has no accessible name
Count of instances: 1
Complaint specifics
- Images have an accessible name
Complaints by axe
Rule image-alt
image-altDescription: Image has no text alternative
Count of instances: 1
Complaint specifics
- Images must have alternate text; Element does not have an alt attribute; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute; Element's default semantics were not overridden with role="none" or role="presentation"
Complaints by continuum
Rule 89
89Description: img element has no machanism allowing an accessible name to be calculated
Count of instances: 1
Complaint specifics
- This img element does not have a mechanism that allows an accessible name value to be calculated
Complaints by htmlcs
Rule AAA.1_1_1.H37
AAA.1_1_1.H37Description: img element has no alt attribute
Count of instances: 1
Complaint specifics
- Img element missing an alt attribute. Use the alt attribute to specify a short text alternative.
Complaints by ibm
Rule img_alt_valid
img_alt_validDescription: Image has neither an alt attribute nor an ARIA label or title
Count of instances: 1
Complaint specifics
- The image has neither an alt atttribute nor an ARIA label or title
Complaints by nuVal
Rule An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.
An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.Description: img element has no alt attribute
Count of instances: 3
Complaint specifics
- An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.
Complaints by qualWeb
Rule QW-ACT-R17
QW-ACT-R17Description: Image has no accessible name
Count of instances: 1
Complaint specifics
- This rule checks that each image that is not marked as decorative, has an accessible name.
Complaints by wave
Rule alt_spacer_missing
alt_spacer_missingDescription: Spacer image has no text alternative
Count of instances: 1
Complaint specifics
- Spacer image missing alternative text
Issue contrastAAA
WCAG: 1.4.6
Score: 12
Complaints by alfa
Rule r66
r66Description: Text contrast less than AAA requires
Count of instances: 6
Complaint specifics
- Text outside widget has enhanced contrast
Complaints by axe
Rule color-contrast-enhanced
color-contrast-enhancedDescription: Element has insufficient color contrast (Level AAA)
Count of instances: 1
Complaint specifics
- Elements must meet enhanced color contrast ratio thresholds; Element has insufficient color contrast of 4.68 (foreground color: #ffffff, background color: #e1251b, font size: 11.3pt (15px), font weight: bold). Expected contrast ratio of 7:1
Complaints by htmlcs
Rule AAA.1_4_6.G17.Fail
AAA.1_4_6.G17.FailDescription: Text has insufficient contrast
Count of instances: 3
Complaint specifics
- This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #595959.
- This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 4.69:1. Recommendation: change background to #b40900.
Complaints by qualWeb
Rule QW-ACT-R76
QW-ACT-R76Description: Text has less than the enhanced minimum contrast
Count of instances: 12
Complaint specifics
- This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.
Issue obsolete
WCAG: 4.1
Score: 12
Complaints by ibm
Rule element_attribute_deprecated
element_attribute_deprecatedDescription: Element or attribute is obsolete
Count of instances: 4
Complaint specifics
- The HTML attribute(s) "version" is deprecated in HTML 5
Issue metaBad
WCAG: 1.3.1
Score: 12
Complaints by nuVal
Rule ^Attribute .+ not allowed on element meta at this point.*$
^Attribute .+ not allowed on element meta at this point.*$Description: Attribute is not allowed on a meta element here
Count of instances: 2
Complaint specifics
- Attribute name not allowed on element meta at this point.
Rule ^Element meta is missing one or more of the following attributes: .+$
Description: meta element is missing a required attribute
Count of instances: 2
Complaint specifics
- Element meta is missing one or more of the following attributes: itemprop, property.
Issue cssInvalid
WCAG: 4.1
Score: 12
Complaints by nuVal
Rule ^CSS: .+: Character .+ is neither a decimal digit number.*$
^CSS: .+: Character .+ is neither a decimal digit number.*$Description: Nonnumeric character in a numeric style property
Count of instances: 4
Complaint specifics
- CSS: height: Character N is neither a decimal digit number, decimal point, nor "e" notation exponential mark.
Issue pseudoNavList
WCAG: 1.3.1
Score: 12
Complaints by qualWeb
Rule QW-WCAG-T32
QW-WCAG-T32Description: ol, ul or dl is not used for a list or group of links
Count of instances: 6
Complaint specifics
- The objective of this technique is to create lists of related items using list elements appropriate for their purposes.
Issue zIndexNotZero
WCAG: 1.4
Score: 12
Complaints by testaro
Rule zIndex
zIndexDescription: Layering with nondefault z-index values
Count of instances: 12
Complaint specifics
- NAV element has a non-default Z index
- DIV element has a non-default Z index
- UL element has a non-default Z index
Issue linkTextsSame
WCAG: 2.4.4
Score: 10
Complaints by tenon
Rule 98
98Description: Links have the same text but different destinations
Count of instances: 5
Complaint specifics
- These links have the same text but different destinations.
Issue repeatedContentRisk
WCAG: 2.4.1
Score: 9
Complaints by alfa
Rule r87
r87Description: First focusable element is not a link to the main content
Count of instances: 1
Complaint specifics
- First focusable element is link to main content
Complaints by qualWeb
Rule QW-ACT-R73
QW-ACT-R73Description: Block of repeated content is not collapsible
Count of instances: 1
Complaint specifics
- This rule checks that repeated blocks of content are collapsible.
Rule QW-ACT-R74
Description: Document has no instrument to move focus to non-repeated content
Count of instances: 1
Complaint specifics
- This rule checks that there is an instrument to move focus to non-repeated content in the page.
Rule QW-WCAG-T23
Description: No link at the top of the page that goes directly to the main content area
Count of instances: 1
Complaint specifics
- The objective of this technique is to provide a mechanism to bypass blocks of material that are repeated on multiple Web pages by skipping directly to the main content of the Web page.
Rule QW-BP17
Description: No link at the beginning of a block of repeated content goes to the end of the block
Count of instances: 6
Complaint specifics
- The objective of this technique is to provide a mechanism to bypass a block of material by skipping to the end of the block.
Issue submitButton
WCAG: 2.5.6
Score: 9
Complaints by qualWeb
Rule QW-WCAG-T19
QW-WCAG-T19Description: Submit button not provided
Count of instances: 3
Complaint specifics
- The objective of this technique is to provide a mechanism that allows users to explicitly request changes of context. The intended use of a submit button is to generate an HTTP request that submits data entered in a form, so it is an appropriate control to use for causing a change of context.
Issue leadingInsufficient
WCAG: 1.4.8
Score: 8
Complaints by alfa
Rule r73
r73Description: Paragraph of text has insufficient line height
Count of instances: 4
Complaint specifics
- Paragraphs of text have sufficient line height
Issue parentBad
WCAG: 1.3.1
Score: 8
Complaints by nuVal
Rule ^Element .+ not allowed as child of element .+ in this context.*$
^Element .+ not allowed as child of element .+ in this context.*$Description: Element has an invalid parent
Count of instances: 2
Complaint specifics
- Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)
Issue leadingClipsText
WCAG: 1.4.8
Score: 8
Complaints by tenon
Rule 144
144Description: Line height is insufficent to properly display the computed font size
Count of instances: 2
Complaint specifics
- This content's line height is insufficent to properly display the computed element font size.
Issue hoverSurprise
WCAG: 1.4.13
Score: 8
Complaints by testaro
Rule hover
hoverDescription: Hovering is impossible or mis-indicated or changes content
Count of instances: 4
Complaint specifics
- Hovering over element has unexpected effects
- Link or button makes the hovering mouse cursor nonstandard
- List item changes when hovered over
Issue navConfusion
WCAG: 1.3.6
Score: 6
Complaints by continuum
Rule 531
531Description: nav element has an accessible name that is non-unique among the nav elements
Count of instances: 2
Complaint specifics
- This nav does not have a unique accessible name as required when two or more nav elements are present
Issue navNoText
WCAG: 1.3.6
Score: 6
Complaints by continuum
Rule 533
533Description: nav element is not the only nav element but has no accessible name
Count of instances: 2
Complaint specifics
- This nav does not have an accessible name as required when two or more nav elements are present
Issue parseError
WCAG: 4.1
Score: 6
Complaints by nuVal
Rule ^Bad start tag in .+$
^Bad start tag in .+$Description: Invalid start tag
Count of instances: 2
Complaint specifics
- Bad start tag in img in noscript in head.
Issue skipRepeatedContent
WCAG: 2.4.1
Score: 6
Complaints by qualWeb
Rule QW-ACT-R64
QW-ACT-R64Description: Document has no heading for non-repeated content
Count of instances: 1
Complaint specifics
- This rule checks that the non-repeated content contains a heading
Rule QW-ACT-R75
Description: Blocks of repeated content cannot be bypassed
Count of instances: 1
Complaint specifics
- This rule checks that each page has a mechanism to bypass repeated blocks of content.
Issue fontSmall
WCAG: 1.4
Score: 6
Complaints by tenon
Rule 134
134Description: Text is very small
Count of instances: 2
Complaint specifics
- Very small text found.
Issue focusableOperable
WCAG: 2.1.1
Score: 6
Complaints by testaro
Rule focOp
focOpDescription: Tab-focusable elements that are inoperable or operable elements that are not focusable
Count of instances: 2
Complaint specifics
Issue typeRedundant
WCAG: 1.3.1
Score: 5
Complaints by nuVal
Rule The type attribute is unnecessary for JavaScript resources.
The type attribute is unnecessary for JavaScript resources.Description: type attribute is unnecessary for a JavaScript resource
Count of instances: 5
Complaint specifics
- The type attribute is unnecessary for JavaScript resources.
Issue justification
WCAG: 1.4.8
Score: 4
Complaints by alfa
Rule r71
r71Description: Paragraph text is fully justified
Count of instances: 1
Complaint specifics
- Paragraphs of text are not justified
Complaints by tenon
Rule 36
36Description: Text is fully justified
Count of instances: 2
Complaint specifics
- This text is justified.
Complaints by wave
Rule text_justified
text_justifiedDescription: Text is justified
Count of instances: 2
Complaint specifics
- Justified text
Issue internalLinkBroken
WCAG: 1.3.1
Score: 4
Complaints by htmlcs
Rule AAA.2_4_1.G1,G123,G124.NoSuchID
AAA.2_4_1.G1,G123,G124.NoSuchIDDescription: Internal link references a nonexistent destination
Count of instances: 1
Complaint specifics
- This link points to a named anchor "hypwppzmyxfaauwaoqlepkgzooebdhllfosv" within the document, but no anchor exists with that name.
Complaints by wave
Rule link_internal_broken
link_internal_brokenDescription: Broken same-page link
Count of instances: 1
Complaint specifics
- Broken same-page link
Issue textRotated
WCAG: 1.4.8
Score: 4
Complaints by tenon
Rule 271
271Description: Text is needlessly rotated 60+ degrees or more, hurting comprehension
Count of instances: 2
Complaint specifics
- This text is rotated from the horizontal by 60 degrees or more.
Issue inconsistentStyles
WCAG: 3.2.4
Score: 4
Complaints by testaro
Rule styleDiff
styleDiffDescription: Heading, link, and button style inconsistencies
Count of instances: 4
Complaint specifics
- In-line links have 5 different styles
Issue linkPair
WCAG: 2.4.4
Score: 4
Complaints by wave
Rule link_redundant
link_redundantDescription: Adjacent links go to the same URL
Count of instances: 2
Complaint specifics
- Redundant link
Issue noHeading
WCAG: 1.3.1
Score: 3
Complaints by alfa
Rule r59
r59Description: Document has no headings
Count of instances: 1
Complaint specifics
- Documents have headings
Complaints by wave
Rule heading_missing
heading_missingDescription: Page has no headings
Count of instances: 1
Complaint specifics
- No heading structure
Issue landmarkConfusion
WCAG: 1.3.6
Score: 3
Complaints by axe
Rule landmark-unique
landmark-uniqueDescription: Landmark has a role and an accessible name that are identical to another
Count of instances: 1
Complaint specifics
- Ensures landmarks are unique; The landmark must have a unique aria-label, aria-labelledby, or title to make landmarks distinguishable
Issue h1Missing
WCAG: 1.3.1
Score: 3
Complaints by axe
Rule page-has-heading-one
page-has-heading-oneDescription: Page contains no level-one heading
Count of instances: 1
Complaint specifics
- Page should contain a level-one heading; Page must have a level-one heading
Issue decorativeImageRisk
WCAG: 1.1.1
Score: 3
Complaints by htmlcs
Rule AAA.1_1_1.H67.2
AAA.1_1_1.H67.2Description: Image marked as decorative may be informative
Count of instances: 3
Complaint specifics
- Img element is marked so that it is ignored by Assistive Technology.
Issue scrollRisk
WCAG: 1.4.10
Score: 3
Complaints by htmlcs
Rule AAA.1_4_10.C32,C31,C33,C38,SCR34,G206
AAA.1_4_10.C32,C31,C33,C38,SCR34,G206Description: Fixed-position element may force bidirectional scrolling
Count of instances: 3
Complaint specifics
- This element has "position: fixed". This may require scrolling in two dimensions, which is considered a failure of this Success Criterion.
Issue roleBad
WCAG: 4.1.2
Score: 3
Complaints by ibm
Rule aria_contentinfo_misuse
aria_contentinfo_misuseDescription: Element with a contentinfo role is present without an element with a main role
Count of instances: 1
Complaint specifics
- The element with "contentinfo" role is present without an element with "main" role
Issue horizontalScrolling
WCAG: 1.4.10
Score: 3
Complaints by tenon
Rule 28
28Description: Layout or sizing of the page causes horizontal scrolling
Count of instances: 1
Complaint specifics
- The layout or sizing of this page causes horizontal scrolling.
Issue linkVague
WCAG: 2.4.4
Score: 3
Complaints by tenon
Rule 73
73Description: Link text is too generic to communicate the purpose or destination
Count of instances: 1
Complaint specifics
- This link text is uninformative.
Issue autocompleteNone
WCAG: 1.3.5
Score: 3
Complaints by testaro
Rule autocomplete
autocompleteDescription: Name or email input is missing its required autocomplete attribute
Count of instances: 3
Complaint specifics
- Input is missing the required autocomplete attribute with value email
Issue mainNone
WCAG: 1.3.6
Score: 2
Complaints by axe
Rule landmark-one-main
landmark-one-mainDescription: page has no main landmark
Count of instances: 1
Complaint specifics
- Document should have one main landmark; Document does not have a main landmark
Complaints by qualWeb
Rule QW-ACT-R63
QW-ACT-R63Description: Document has no landmark with non-repeated content
Count of instances: 1
Complaint specifics
- This rule checks that each page has an element with a landmark semantic role starting with non-repeated content
Issue justificationRisk
WCAG: 1.4.8
Score: 2
Complaints by qualWeb
Rule QW-WCAG-T29
QW-WCAG-T29Description: Alignment either to the left or right is not specified in CSS
Count of instances: 2
Complaint specifics
- This technique describes how to align blocks of text either left or right by setting the CSS text-align property.
Issue noScriptRisk
WCAG: 4.1
Score: 2
Complaints by wave
Rule noscript
noscriptDescription: noscript element may fail to contain an accessible equivalent or alternative
Count of instances: 2
Complaint specifics
- Noscript element
Issue contrastRisk
WCAG: 1.4.3
Score: 1
Complaints by htmlcs
Rule AAA.1_4_3_F24.F24.FGColour
AAA.1_4_3_F24.F24.FGColourDescription: Inline foreground color may lack a complementary background color
Count of instances: 1
Complaint specifics
- Check that this element has an inherited background colour or image to complement the corresponding inline foreground colour.
Issue visibleBulk
WCAG: 2.4
Score: 1
Complaints by testaro
Rule bulk
bulkDescription: Page contains many visible elements
Count of instances: 1
Complaint specifics
- Page contains a large number of visible elements
Complete report
{
"id": "18ixx-ts27-caAD5-c",
"what": "accessibility tests",
"strict": true,
"timeLimit": 330,
"acts": [
{
"type": "launch",
"which": "webkit",
"startTime": 1687099488340,
"endTime": 1687099488914
},
{
"type": "url",
"which": "https://joepatterson.com/",
"what": "Candidate Joe Patterson (R)",
"startTime": 1687099488914,
"result": {
"url": "https://joepatterson.com/"
},
"endTime": 1687099490678
},
{
"type": "tenonRequest",
"id": "a",
"withNewContent": false,
"what": "Tenon API version 2 test request, with page content",
"startTime": 1687099490679,
"url": "https://joepatterson.com/",
"endTime": 1687099491959
},
{
"type": "test",
"which": "testaro",
"what": "Testaro",
"withItems": true,
"rules": [
"y",
"motion"
],
"startTime": 1687099491959,
"url": "https://joepatterson.com/",
"result": {
"rules": {
"motion": {
"what": "motion without user request",
"data": {
"bytes": [
302393,
302393,
302393,
302393,
302393
],
"localRatios": [
1,
1,
1,
1
],
"meanLocalRatio": 1,
"maxLocalRatio": 1,
"globalRatio": 1,
"pixelChanges": [
0,
0,
0,
0
],
"meanPixelChange": 0,
"maxPixelChange": 0,
"changeFrequency": 0
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
}
},
"success": true
},
"standardResult": {
"totals": [
0,
0,
0,
0
],
"instances": []
},
"endTime": 1687099505453
},
{
"type": "launch",
"which": "chromium",
"startTime": 1687099505453,
"endTime": 1687099506089
},
{
"type": "url",
"which": "https://joepatterson.com/",
"what": "Candidate Joe Patterson (R)",
"startTime": 1687099506089,
"result": {
"url": "https://joepatterson.com/"
},
"endTime": 1687099507351
},
{
"type": "test",
"which": "alfa",
"startTime": 1687099507351,
"url": "https://joepatterson.com/",
"what": "alfa",
"result": {
"totals": {
"failures": 42,
"warnings": 45
},
"items": [
{
"index": 2,
"verdict": "failed",
"rule": {
"ruleID": "r11",
"ruleSummary": "Links have an accessible name",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r11",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#link-purpose-in-context",
"chapter": "2.4.4",
"title": "Link Purpose (In Context)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#link-purpose-link-only",
"chapter": "2.4.9",
"title": "Link Purpose (Link Only)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#name-role-value",
"chapter": "4.1.2",
"title": "Name, Role, Value"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G91",
"name": "G91",
"title": "Providing link text that describes the purpose of a link"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"codeLines": [
"<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\">",
" <picture class=\"brz-picture brz-d-block brz-p-relative brz-css-ptqop\">",
" <img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">",
" </picture>",
"</a>"
]
}
},
{
"index": 21,
"verdict": "failed",
"rule": {
"ruleID": "r11",
"ruleSummary": "Links have an accessible name",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r11",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#link-purpose-in-context",
"chapter": "2.4.4",
"title": "Link Purpose (In Context)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#link-purpose-link-only",
"chapter": "2.4.9",
"title": "Link Purpose (Link Only)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#name-role-value",
"chapter": "4.1.2",
"title": "Name, Role, Value"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G91",
"name": "G91",
"title": "Providing link text that describes the purpose of a link"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"codeLines": [
"<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span brz-icon css-1yqt0eo\">",
" <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg\" data-type=\"glyph\" data-name=\"logo-facebook\">",
" <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
" <path fill=\"currentColor\" d=\"M22,0H2C0.895,0,0,0.895,0,2v20c0,1.105,0.895,2,2,2h11v-9h-3v-4h3V8.413c0-3.1,1.893-4.788,4.659-4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\"></path...",
" </g>",
" </svg>",
" </span>",
"</a>"
]
}
},
{
"index": 22,
"verdict": "failed",
"rule": {
"ruleID": "r11",
"ruleSummary": "Links have an accessible name",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r11",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#link-purpose-in-context",
"chapter": "2.4.4",
"title": "Link Purpose (In Context)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#link-purpose-link-only",
"chapter": "2.4.9",
"title": "Link Purpose (Link Only)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#name-role-value",
"chapter": "4.1.2",
"title": "Name, Role, Value"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G91",
"name": "G91",
"title": "Providing link text that describes the purpose of a link"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
"codeLines": [
"<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span brz-icon css-1ldonqd\">",
" <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg\" data-type=\"glyph\" data-name=\"logo-twitter\">",
" <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
" <path fill=\"currentColor\" d=\"M24,4.6c-0.9,0.4-1.8,0.7-2.8,0.8c1-0.6,1.8-1.6,2.2-2.7c-1,0.6-2,1-3.1,1.2c-0.9-1-2.2-1.6-3.6-1.6 c-2.7,0-4.9,2.2-4.9,4.9c0,0.4,0,0.8,0.1,1.1C7.7,8.1,4.1,6.1,1.7,3.1C1.2,3.9,1,4.7,1,5.6c0,1.7,0.9,3.2,2.2,4.1 C2.4,9.7,1.6,9.5,1,9.1c0,0,0,0,0,0.1c0,2.4,1.7,4.4,3.9,4...",
" </g>",
" </svg>",
" </span>",
"</a>"
]
}
},
{
"index": 36,
"verdict": "failed",
"rule": {
"ruleID": "r2",
"ruleSummary": "Images have an accessible name",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r2",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#non-text-content",
"chapter": "1.1.1",
"title": "Non-text Content"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G94",
"name": "G94",
"title": "Providing short text alternative for non-text content that serves the same purpose"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G95",
"name": "G95",
"title": "Providing short text alternatives that provide a brief description of the non-text"
}
]
},
"target": {
"type": "element",
"tagName": "img",
"path": "/html[1]/body[1]/img[1]",
"codeLines": [
"<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">"
]
}
},
{
"index": 75,
"verdict": "failed",
"rule": {
"ruleID": "r3",
"ruleSummary": "id attributes have a unique value",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r3",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#parsing",
"chapter": "4.1.1",
"title": "Parsing"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
"name": "H93",
"title": "Ensuring that id attributes are unique on a Web page"
}
]
},
"target": {
"type": "element",
"tagName": "g",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]",
"codeLines": [
"<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">",
" <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
" <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
"</g>"
]
}
},
{
"index": 76,
"verdict": "failed",
"rule": {
"ruleID": "r3",
"ruleSummary": "id attributes have a unique value",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r3",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#parsing",
"chapter": "4.1.1",
"title": "Parsing"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
"name": "H93",
"title": "Ensuring that id attributes are unique on a Web page"
}
]
},
"target": {
"type": "element",
"tagName": "path",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[1]",
"codeLines": [
"<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
]
}
},
{
"index": 77,
"verdict": "failed",
"rule": {
"ruleID": "r3",
"ruleSummary": "id attributes have a unique value",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r3",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#parsing",
"chapter": "4.1.1",
"title": "Parsing"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
"name": "H93",
"title": "Ensuring that id attributes are unique on a Web page"
}
]
},
"target": {
"type": "element",
"tagName": "path",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[2]",
"codeLines": [
"<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
]
}
},
{
"index": 112,
"verdict": "failed",
"rule": {
"ruleID": "r3",
"ruleSummary": "id attributes have a unique value",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r3",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#parsing",
"chapter": "4.1.1",
"title": "Parsing"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
"name": "H93",
"title": "Ensuring that id attributes are unique on a Web page"
}
]
},
"target": {
"type": "element",
"tagName": "g",
"path": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]",
"codeLines": [
"<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">",
" <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
" <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
"</g>"
]
}
},
{
"index": 113,
"verdict": "failed",
"rule": {
"ruleID": "r3",
"ruleSummary": "id attributes have a unique value",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r3",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#parsing",
"chapter": "4.1.1",
"title": "Parsing"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
"name": "H93",
"title": "Ensuring that id attributes are unique on a Web page"
}
]
},
"target": {
"type": "element",
"tagName": "path",
"path": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[1]",
"codeLines": [
"<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
]
}
},
{
"index": 114,
"verdict": "failed",
"rule": {
"ruleID": "r3",
"ruleSummary": "id attributes have a unique value",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r3",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#parsing",
"chapter": "4.1.1",
"title": "Parsing"
},
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/html/H93",
"name": "H93",
"title": "Ensuring that id attributes are unique on a Web page"
}
]
},
"target": {
"type": "element",
"tagName": "path",
"path": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[2]",
"codeLines": [
"<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
]
}
},
{
"index": 167,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]/span[1]/text()[1]",
"codeLines": [
"DONATE"
]
}
},
{
"index": 168,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
"codeLines": [
"THANK YOU!"
]
}
},
{
"index": 169,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]",
"codeLines": [
"Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
]
}
},
{
"index": 170,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]",
"codeLines": [
"-Joe Patterson"
]
}
},
{
"index": 171,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[2]/div[1]/div[1]/p[1]/strong[1]/text()[1]",
"codeLines": [
"JOE PATTERSON"
]
}
},
{
"index": 172,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[3]/div[1]/div[1]/p[1]/span[1]/text()[1]",
"codeLines": [
"Your voice in the State Assembly."
]
}
},
{
"index": 173,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
"codeLines": [
"STAND WITH JOE:"
]
}
},
{
"index": 174,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]/span[1]/text()[1]",
"codeLines": [
"$5"
]
}
},
{
"index": 175,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]/span[1]/text()[1]",
"codeLines": [
"$10"
]
}
},
{
"index": 176,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]/span[1]/text()[1]",
"codeLines": [
"$25"
]
}
},
{
"index": 177,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]/span[1]/text()[1]",
"codeLines": [
"$50"
]
}
},
{
"index": 178,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]/span[1]/text()[1]",
"codeLines": [
"$75"
]
}
},
{
"index": 179,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]/span[1]/text()[1]",
"codeLines": [
"OTHER"
]
}
},
{
"index": 180,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
"codeLines": [
"JOIN THE TEAM"
]
}
},
{
"index": 181,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]/span[1]/text()[1]",
"codeLines": [
"SUBMIT"
]
}
},
{
"index": 182,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
"codeLines": [
"Meet Joe Patterson"
]
}
},
{
"index": 183,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]",
"codeLines": [
"Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
]
}
},
{
"index": 184,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]/span[1]/text()[1]",
"codeLines": [
"Learn More"
]
}
},
{
"index": 185,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/strong[1]/text()[1]",
"codeLines": [
"Endorse Joe"
]
}
},
{
"index": 186,
"verdict": "failed",
"rule": {
"ruleID": "r57",
"ruleSummary": "Perceivable text content is included in a landmark",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r57",
"requirements": []
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[5]/button[1]/span[1]/text()[1]",
"codeLines": [
"Endorse Joe!"
]
}
},
{
"index": 196,
"verdict": "failed",
"rule": {
"ruleID": "r59",
"ruleSummary": "Documents have headings",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r59",
"requirements": []
},
"target": {
"type": "document",
"tagName": "",
"path": "/",
"codeLines": [
"#document",
" <!doctype html>",
"...",
" </html>"
]
}
},
{
"index": 203,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"codeLines": [
"<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\">",
" <picture class=\"brz-picture brz-d-block brz-p-relative brz-css-ptqop\">",
" <img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">",
" </picture>",
"</a>"
]
}
},
{
"index": 204,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]",
"codeLines": [
"<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span\">",
" Home",
" </span>",
"</a>"
]
}
},
{
"index": 205,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]",
"codeLines": [
"<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span\">",
" Meet Joe",
" </span>",
"</a>"
]
}
},
{
"index": 206,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]",
"codeLines": [
"<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span\">",
" News",
" </span>",
"</a>"
]
}
},
{
"index": 207,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]",
"codeLines": [
"<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span\">",
" AD5",
" </span>",
"</a>"
]
}
},
{
"index": 208,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]",
"codeLines": [
"<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span\">",
" Issues",
" </span>",
"</a>"
]
}
},
{
"index": 209,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]",
"codeLines": [
"<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">",
" <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-css-oheuj\" data-type=\"glyph\" data-name=\"tail-right\">",
" <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
" <path fill=\"currentColor\" d=\"M22.707,11.293L15,3.586L13.586,5l6,6H2c-0.553,0-1,0.448-1,1s0.447,1,1,1h17.586l-6,6L15,20.414 l7.707-7.707C23.098,12.316,23.098,11.684,22.707,11.293z\"></path>",
" </g>",
" </svg>",
" <span class=\"brz-span brz-text__editor\">",
" DONATE",
" </span>",
"</a>"
]
}
},
{
"index": 210,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]",
"codeLines": [
"<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">",
" <span class=\"brz-span brz-text__editor\">",
" $5",
" </span>",
"</a>"
]
}
},
{
"index": 211,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]",
"codeLines": [
"<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">",
" <span class=\"brz-span brz-text__editor\">",
" $10",
" </span>",
"</a>"
]
}
},
{
"index": 212,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]",
"codeLines": [
"<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">",
" <span class=\"brz-span brz-text__editor\">",
" $25",
" </span>",
"</a>"
]
}
},
{
"index": 213,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]",
"codeLines": [
"<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">",
" <span class=\"brz-span brz-text__editor\">",
" $50",
" </span>",
"</a>"
]
}
},
{
"index": 214,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]",
"codeLines": [
"<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">",
" <span class=\"brz-span brz-text__editor\">",
" $75",
" </span>",
"</a>"
]
}
},
{
"index": 215,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]",
"codeLines": [
"<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">",
" <span class=\"brz-span brz-text__editor\">",
" OTHER",
" </span>",
"</a>"
]
}
},
{
"index": 216,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "input",
"path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[1]/input[1]",
"codeLines": [
"<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
]
}
},
{
"index": 217,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "input",
"path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[2]/input[1]",
"codeLines": [
"<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
]
}
},
{
"index": 218,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "input",
"path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[3]/input[1]",
"codeLines": [
"<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+..."
]
}
},
{
"index": 219,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "input",
"path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[4]/input[1]",
"codeLines": [
"<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
]
}
},
{
"index": 220,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "input",
"path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[5]/input[1]",
"codeLines": [
"<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
]
}
},
{
"index": 221,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "button",
"path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]",
"codeLines": [
"<button class=\"brz-btn brz-btn-submit brz-css-ystbj\" data-custom-id=\"nxouluvbretczsumlwfttgzfltqnntvlwvaf\">",
" <span class=\"brz-span brz-text__editor\">",
" SUBMIT",
" </span>",
" <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
" <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
" <g class=\"nc-loop_circle-02-24\" transform=\"rotate(241.37571428571425 12 12)\">",
" <path opacity=\"0.4\" fill=\"currentColor\" d=\"M12,24C5.3833008,24,0,18.6166992,0,12S5.3833008,0,12,0s12,5.3833008,12,12 S18.6166992,24,12,24z M12,2C6.4858398,2,2,6.4858398,2,12s4.4858398,10,10,10s10-4.4858398,10-10S17.5141602,2,12,2z\"></path>",
" <path data-color=\"color-2\" fill=\"currentColor\" d=\"M24,12h-2c0-5.5141602-4.4858398-10-10-10V0C18.6166992,0,24,5.3833008,24,12z\"></path>",
" </g>",
" <script>",
" !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,...",
" </script>",
" </g>",
" </svg>",
"</button>"
]
}
},
{
"index": 222,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]",
"codeLines": [
"<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\">",
" <span class=\"brz-span brz-text__editor\">",
" Learn More",
" </span>",
"</a>"
]
}
},
{
"index": 223,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "input",
"path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[1]/input[1]",
"codeLines": [
"<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
]
}
},
{
"index": 224,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "input",
"path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[2]/input[1]",
"codeLines": [
"<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
]
}
},
{
"index": 225,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "input",
"path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[3]/input[1]",
"codeLines": [
"<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\..."
]
}
},
{
"index": 226,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "input",
"path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[4]/input[1]",
"codeLines": [
"<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
]
}
},
{
"index": 227,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "button",
"path": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[5]/button[1]",
"codeLines": [
"<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-dyvgx\" data-custom-id=\"pctxnochcdlwubleyhhicvdleifnqiyrttuh\">",
" <span class=\"brz-span brz-text__editor\">",
" Endorse Joe!",
" </span>",
" <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
" <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
" <g class=\"nc-loop_circle-02-24\" transform=\"rotate(241.37571428571425 12 12)\">",
" <path opacity=\"0.4\" fill=\"currentColor\" d=\"M12,24C5.3833008,24,0,18.6166992,0,12S5.3833008,0,12,0s12,5.3833008,12,12 S18.6166992,24,12,24z M12,2C6.4858398,2,2,6.4858398,2,12s4.4858398,10,10,10s10-4.4858398,10-10S17.5141602,2,12,2z\"></path>",
" <path data-color=\"color-2\" fill=\"currentColor\" d=\"M24,12h-2c0-5.5141602-4.4858398-10-10-10V0C18.6166992,0,24,5.3833008,24,12z\"></path>",
" </g>",
" <script>",
" !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,...",
" </script>",
" </g>",
" </svg>",
"</button>"
]
}
},
{
"index": 228,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]",
"codeLines": [
"<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span\">",
" Home",
" </span>",
"</a>"
]
}
},
{
"index": 229,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]",
"codeLines": [
"<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span\">",
" Meet Joe",
" </span>",
"</a>"
]
}
},
{
"index": 230,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]",
"codeLines": [
"<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span\">",
" News",
" </span>",
"</a>"
]
}
},
{
"index": 231,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]",
"codeLines": [
"<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span\">",
" AD5",
" </span>",
"</a>"
]
}
},
{
"index": 232,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]",
"codeLines": [
"<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span\">",
" Issues",
" </span>",
"</a>"
]
}
},
{
"index": 233,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "input",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[1]/input[1]",
"codeLines": [
"<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\..."
]
}
},
{
"index": 234,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "button",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[2]/button[1]",
"codeLines": [
"<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-rplcf\" data-custom-id=\"urngpgulgkggkfoivjalbjunpabjeeujtqmh\">",
" <span class=\"brz-span brz-text__editor\">",
" SUBMIT",
" </span>",
" <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
" <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
" <g class=\"nc-loop_circle-02-24\" transform=\"rotate(241.37571428571425 12 12)\">",
" <path opacity=\"0.4\" fill=\"currentColor\" d=\"M12,24C5.3833008,24,0,18.6166992,0,12S5.3833008,0,12,0s12,5.3833008,12,12 S18.6166992,24,12,24z M12,2C6.4858398,2,2,6.4858398,2,12s4.4858398,10,10,10s10-4.4858398,10-10S17.5141602,2,12,2z\"></path>",
" <path data-color=\"color-2\" fill=\"currentColor\" d=\"M24,12h-2c0-5.5141602-4.4858398-10-10-10V0C18.6166992,0,24,5.3833008,24,12z\"></path>",
" </g>",
" <script>",
" !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,...",
" </script>",
" </g>",
" </svg>",
"</button>"
]
}
},
{
"index": 235,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"codeLines": [
"<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span brz-icon css-1yqt0eo\">",
" <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg\" data-type=\"glyph\" data-name=\"logo-facebook\">",
" <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
" <path fill=\"currentColor\" d=\"M22,0H2C0.895,0,0,0.895,0,2v20c0,1.105,0.895,2,2,2h11v-9h-3v-4h3V8.413c0-3.1,1.893-4.788,4.659-4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\"></path...",
" </g>",
" </svg>",
" </span>",
"</a>"
]
}
},
{
"index": 236,
"verdict": "cantTell",
"rule": {
"ruleID": "r65",
"ruleSummary": "Element in sequential focus order has visible focus",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r65",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#focus-visible",
"chapter": "2.4.7",
"title": "Focus Visible"
}
]
},
"target": {
"type": "element",
"tagName": "a",
"path": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
"codeLines": [
"<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
" <span class=\"brz-span brz-icon css-1ldonqd\">",
" <svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg\" data-type=\"glyph\" data-name=\"logo-twitter\">",
" <g class=\"nc-icon-wrapper\" fill=\"currentColor\">",
" <path fill=\"currentColor\" d=\"M24,4.6c-0.9,0.4-1.8,0.7-2.8,0.8c1-0.6,1.8-1.6,2.2-2.7c-1,0.6-2,1-3.1,1.2c-0.9-1-2.2-1.6-3.6-1.6 c-2.7,0-4.9,2.2-4.9,4.9c0,0.4,0,0.8,0.1,1.1C7.7,8.1,4.1,6.1,1.7,3.1C1.2,3.9,1,4.7,1,5.6c0,1.7,0.9,3.2,2.2,4.1 C2.4,9.7,1.6,9.5,1,9.1c0,0,0,0,0,0.1c0,2.4,1.7,4.4,3.9,4...",
" </g>",
" </svg>",
" </span>",
"</a>"
]
}
},
{
"index": 238,
"verdict": "cantTell",
"rule": {
"ruleID": "r66",
"ruleSummary": "Text outside widget has enhanced contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r66",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
"codeLines": [
"THANK YOU!"
]
}
},
{
"index": 239,
"verdict": "cantTell",
"rule": {
"ruleID": "r66",
"ruleSummary": "Text outside widget has enhanced contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r66",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]",
"codeLines": [
"Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
]
}
},
{
"index": 240,
"verdict": "cantTell",
"rule": {
"ruleID": "r66",
"ruleSummary": "Text outside widget has enhanced contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r66",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]",
"codeLines": [
"-Joe Patterson"
]
}
},
{
"index": 247,
"verdict": "failed",
"rule": {
"ruleID": "r66",
"ruleSummary": "Text outside widget has enhanced contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r66",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]/span[1]/text()[1]",
"codeLines": [
"SUBMIT"
]
}
},
{
"index": 248,
"verdict": "cantTell",
"rule": {
"ruleID": "r66",
"ruleSummary": "Text outside widget has enhanced contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r66",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
"codeLines": [
"Meet Joe Patterson"
]
}
},
{
"index": 249,
"verdict": "cantTell",
"rule": {
"ruleID": "r66",
"ruleSummary": "Text outside widget has enhanced contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r66",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]",
"codeLines": [
"Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
]
}
},
{
"index": 266,
"verdict": "cantTell",
"rule": {
"ruleID": "r69",
"ruleSummary": "Text outside widget has minimum contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r69",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-minimum",
"chapter": "1.4.3",
"title": "Contrast (Minimum)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
"codeLines": [
"THANK YOU!"
]
}
},
{
"index": 267,
"verdict": "cantTell",
"rule": {
"ruleID": "r69",
"ruleSummary": "Text outside widget has minimum contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r69",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-minimum",
"chapter": "1.4.3",
"title": "Contrast (Minimum)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]",
"codeLines": [
"Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
]
}
},
{
"index": 268,
"verdict": "cantTell",
"rule": {
"ruleID": "r69",
"ruleSummary": "Text outside widget has minimum contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r69",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-minimum",
"chapter": "1.4.3",
"title": "Contrast (Minimum)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]",
"codeLines": [
"-Joe Patterson"
]
}
},
{
"index": 276,
"verdict": "cantTell",
"rule": {
"ruleID": "r69",
"ruleSummary": "Text outside widget has minimum contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r69",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-minimum",
"chapter": "1.4.3",
"title": "Contrast (Minimum)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]",
"codeLines": [
"Meet Joe Patterson"
]
}
},
{
"index": 277,
"verdict": "cantTell",
"rule": {
"ruleID": "r69",
"ruleSummary": "Text outside widget has minimum contrast",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r69",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-minimum",
"chapter": "1.4.3",
"title": "Contrast (Minimum)"
},
{
"uri": "https://www.w3.org/TR/WCAG2/#contrast-enhanced",
"chapter": "1.4.6",
"title": "Contrast (Enhanced)"
}
]
},
"target": {
"type": "text",
"tagName": "",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]",
"codeLines": [
"Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
]
}
},
{
"index": 283,
"verdict": "failed",
"rule": {
"ruleID": "r71",
"ruleSummary": "Paragraphs of text are not justified",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r71",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
"chapter": "1.4.8",
"title": "Visual Presentation"
}
]
},
"target": {
"type": "element",
"tagName": "p",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]",
"codeLines": [
"<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\">",
" <span class=\"brz-cp-color3\">",
" Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol.",
" </span>",
"</p>"
]
}
},
{
"index": 292,
"verdict": "failed",
"rule": {
"ruleID": "r73",
"ruleSummary": "Paragraphs of text have sufficient line height",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r73",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
"chapter": "1.4.8",
"title": "Visual Presentation"
}
]
},
"target": {
"type": "element",
"tagName": "p",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
"codeLines": [
"<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\">",
" <span class=\"brz-cp-color3\">",
" THANK YOU!",
" </span>",
"</p>"
]
}
},
{
"index": 293,
"verdict": "failed",
"rule": {
"ruleID": "r73",
"ruleSummary": "Paragraphs of text have sufficient line height",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r73",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
"chapter": "1.4.8",
"title": "Visual Presentation"
}
]
},
"target": {
"type": "element",
"tagName": "p",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]",
"codeLines": [
"<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\">",
" <span class=\"brz-cp-color3\">",
" Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol.",
" </span>",
"</p>"
]
}
},
{
"index": 294,
"verdict": "failed",
"rule": {
"ruleID": "r73",
"ruleSummary": "Paragraphs of text have sufficient line height",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r73",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
"chapter": "1.4.8",
"title": "Visual Presentation"
}
]
},
"target": {
"type": "element",
"tagName": "p",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]",
"codeLines": [
"<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\">",
" <span class=\"brz-cp-color3\">",
" -Joe Patterson",
" </span>",
"</p>"
]
}
},
{
"index": 295,
"verdict": "failed",
"rule": {
"ruleID": "r73",
"ruleSummary": "Paragraphs of text have sufficient line height",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r73",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
"chapter": "1.4.8",
"title": "Visual Presentation"
}
]
},
"target": {
"type": "element",
"tagName": "p",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
"codeLines": [
"<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\">",
" <span class=\"brz-cp-color1\">",
" Meet Joe Patterson",
" </span>",
"</p>"
]
}
},
{
"index": 297,
"verdict": "failed",
"rule": {
"ruleID": "r74",
"ruleSummary": "Paragraphs of text do not have font sizes defined in absolute units",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r74",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
"chapter": "1.4.8",
"title": "Visual Presentation"
}
]
},
"target": {
"type": "element",
"tagName": "p",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
"codeLines": [
"<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\">",
" <span class=\"brz-cp-color3\">",
" THANK YOU!",
" </span>",
"</p>"
]
}
},
{
"index": 298,
"verdict": "failed",
"rule": {
"ruleID": "r74",
"ruleSummary": "Paragraphs of text do not have font sizes defined in absolute units",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r74",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
"chapter": "1.4.8",
"title": "Visual Presentation"
}
]
},
"target": {
"type": "element",
"tagName": "p",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]",
"codeLines": [
"<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\">",
" <span class=\"brz-cp-color3\">",
" Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol.",
" </span>",
"</p>"
]
}
},
{
"index": 299,
"verdict": "failed",
"rule": {
"ruleID": "r74",
"ruleSummary": "Paragraphs of text do not have font sizes defined in absolute units",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r74",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
"chapter": "1.4.8",
"title": "Visual Presentation"
}
]
},
"target": {
"type": "element",
"tagName": "p",
"path": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]",
"codeLines": [
"<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\">",
" <span class=\"brz-cp-color3\">",
" -Joe Patterson",
" </span>",
"</p>"
]
}
},
{
"index": 300,
"verdict": "failed",
"rule": {
"ruleID": "r74",
"ruleSummary": "Paragraphs of text do not have font sizes defined in absolute units",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r74",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
"chapter": "1.4.8",
"title": "Visual Presentation"
}
]
},
"target": {
"type": "element",
"tagName": "p",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
"codeLines": [
"<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\">",
" <span class=\"brz-cp-color1\">",
" Meet Joe Patterson",
" </span>",
"</p>"
]
}
},
{
"index": 301,
"verdict": "failed",
"rule": {
"ruleID": "r74",
"ruleSummary": "Paragraphs of text do not have font sizes defined in absolute units",
"scope": "component",
"uri": "https://alfa.siteimprove.com/rules/sia-r74",
"requirements": [
{
"uri": "https://www.w3.org/TR/WCAG2/#visual-presentation",
"chapter": "1.4.8",
"title": "Visual Presentation"
}
]
},
"target": {
"type": "element",
"tagName": "p",
"path": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]",
"codeLines": [
"<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">",
" Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, w...",
"</p>"
]
}
},
{
"index": 386,
"verdict": "cantTell",
"rule": {
"ruleID": "r87",
"ruleSummary": "First focusable element is link to main content",
"scope": "page",
"uri": "https://alfa.siteimprove.com/rules/sia-r87",
"requirements": [
{
"uri": "https://www.w3.org/WAI/WCAG21/Techniques/general/G1",
"name": "G1",
"title": "Adding a link at the top of each page that goes directly to the main content area"
}
]
},
"target": {
"type": "document",
"tagName": "",
"path": "/",
"codeLines": [
"#document",
" <!doctype html>",
"...",
" </html>"
]
}
}
],
"success": true
},
"standardResult": {
"totals": [
45,
0,
0,
42
],
"instances": [
{
"ruleID": "r11",
"what": "Links have an accessible name",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"> <picture class=\"brz-picture brz-d-block brz-p-relative brz- ... ss-ptqop\"> <img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\"> </picture> </a>"
},
{
"ruleID": "r11",
"what": "Links have an accessible name",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span brz-icon css-1yqt0eo\"> <svg version=\"1.1 ... 659-4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\"></path... </g> </svg> </span> </a>"
},
{
"ruleID": "r11",
"what": "Links have an accessible name",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span brz-icon css-1ldonqd\"> <svg version=\"1.1\" xmlns=\"http:/ ... 6-1.6 c-2.7,0-4.9,2.2-4.9,4.9c0,0.4,0,0.8,0.1,1.1C7.7,8.1,4.1,6.1,1.7,3.1C1.2,3.9,1,4.7,1,5.6c0,1.7,0.9,3.2,2.2,4.1 C2.4,9.7,1.6,9.5,1,9.1c0,0,0,0,0,0.1c0,2.4,1.7,4.4,3.9,4... </g> </svg> </span> </a>"
},
{
"ruleID": "r2",
"what": "Images have an accessible name",
"ordinalSeverity": 3,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/img[1]"
},
"excerpt": "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">"
},
{
"ruleID": "r3",
"what": "id attributes have a unique value",
"ordinalSeverity": 3,
"tagName": "G",
"id": "close-popup",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]"
},
"excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\"> <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonze ... th> <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path> </g>"
},
{
"ruleID": "r3",
"what": "id attributes have a unique value",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[1]"
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
},
{
"ruleID": "r3",
"what": "id attributes have a unique value",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[2]"
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
},
{
"ruleID": "r3",
"what": "id attributes have a unique value",
"ordinalSeverity": 3,
"tagName": "G",
"id": "close-popup",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]"
},
"excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\"> <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonze ... th> <path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path> </g>"
},
{
"ruleID": "r3",
"what": "id attributes have a unique value",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[1]"
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
},
{
"ruleID": "r3",
"what": "id attributes have a unique value",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[2]"
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]/span[1]/text()[1]"
},
"excerpt": "DONATE"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
},
"excerpt": "THANK YOU!"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]"
},
"excerpt": "Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]"
},
"excerpt": "-Joe Patterson"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[2]/div[1]/div[1]/p[1]/strong[1]/text()[1]"
},
"excerpt": "JOE PATTERSON"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[3]/div[1]/div[1]/p[1]/span[1]/text()[1]"
},
"excerpt": "Your voice in the State Assembly."
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
},
"excerpt": "STAND WITH JOE:"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]/span[1]/text()[1]"
},
"excerpt": "$5"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]/span[1]/text()[1]"
},
"excerpt": "$10"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]/span[1]/text()[1]"
},
"excerpt": "$25"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]/span[1]/text()[1]"
},
"excerpt": "$50"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]/span[1]/text()[1]"
},
"excerpt": "$75"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]/span[1]/text()[1]"
},
"excerpt": "OTHER"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
},
"excerpt": "JOIN THE TEAM"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]/span[1]/text()[1]"
},
"excerpt": "SUBMIT"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
},
"excerpt": "Meet Joe Patterson"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]"
},
"excerpt": "Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]/span[1]/text()[1]"
},
"excerpt": "Learn More"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/strong[1]/text()[1]"
},
"excerpt": "Endorse Joe"
},
{
"ruleID": "r57",
"what": "Perceivable text content is included in a landmark",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[5]/button[1]/span[1]/text()[1]"
},
"excerpt": "Endorse Joe!"
},
{
"ruleID": "r59",
"what": "Documents have headings",
"ordinalSeverity": 3,
"tagName": "",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/"
},
"excerpt": "#document <!doctype html> ... </html>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"> <picture class=\"brz-picture brz-d-block brz-p-relative brz- ... ss-ptqop\"> <img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\"> </picture> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Home </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Meet Joe </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> News </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> AD5 </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Issues </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-i ... 5l6,6H2c-0.553,0-1,0.448-1,1s0.447,1,1,1h17.586l-6,6L15,20.414 l7.707-7.707C23.098,12.316,23.098,11.684,22.707,11.293z\"></path> </g> </svg> <span class=\"brz-span brz-text__editor\"> DONATE </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\"> <span class=\"brz-span brz-text__editor\"> $5 </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\"> <span class=\"brz-span brz-text__editor\"> $10 </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\"> <span class=\"brz-span brz-text__editor\"> $25 </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\"> <span class=\"brz-span brz-text__editor\"> $50 </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\"> <span class=\"brz-span brz-text__editor\"> $75 </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\"> <span class=\"brz-span brz-text__editor\"> OTHER </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[1]/input[1]"
},
"excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[2]/input[1]"
},
"excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[3]/input[1]"
},
"excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+..."
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[4]/input[1]"
},
"excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[5]/input[1]"
},
"excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]"
},
"excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj\" data-custom-id=\"nxouluvbretczsumlwfttgzfltqnntvlwvaf\"> <span class=\"brz-span brz-text__editor\"> SUBMIT </span> <svg version=\"1.1\" xmlns=\"http://www ... ull;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,... </script> </g> </svg> </button>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\"> <span class=\"brz-span brz-text__editor\"> Learn More </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[1]/input[1]"
},
"excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[2]/input[1]"
},
"excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "INPUT",
"id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[3]/input[1]"
},
"excerpt": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\..."
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[4]/input[1]"
},
"excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[5]/button[1]"
},
"excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-dyvgx\" data-custom-id=\"pctxnochcdlwubleyhhicvdleifnqiyrttuh\"> <span class=\"brz-span brz-text__editor\"> Endorse Joe! </span> <svg version=\"1. ... ull;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,... </script> </g> </svg> </button>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Home </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Meet Joe </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> News </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> AD5 </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span\"> Issues </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "INPUT",
"id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[1]/input[1]"
},
"excerpt": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\..."
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/form[1]/div[2]/button[1]"
},
"excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-rplcf\" data-custom-id=\"urngpgulgkggkfoivjalbjunpabjeeujtqmh\"> <span class=\"brz-span brz-text__editor\"> SUBMIT </span> <svg version=\"1.1\" xml ... ull;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,... </script> </g> </svg> </button>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span brz-icon css-1yqt0eo\"> <svg version=\"1.1 ... 659-4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\"></path... </g> </svg> </span> </a>"
},
{
"ruleID": "r65",
"what": "Element in sequential focus order has visible focus",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"> <span class=\"brz-span brz-icon css-1ldonqd\"> <svg version=\"1.1\" xmlns=\"http:/ ... 6-1.6 c-2.7,0-4.9,2.2-4.9,4.9c0,0.4,0,0.8,0.1,1.1C7.7,8.1,4.1,6.1,1.7,3.1C1.2,3.9,1,4.7,1,5.6c0,1.7,0.9,3.2,2.2,4.1 C2.4,9.7,1.6,9.5,1,9.1c0,0,0,0,0,0.1c0,2.4,1.7,4.4,3.9,4... </g> </svg> </span> </a>"
},
{
"ruleID": "r66",
"what": "Text outside widget has enhanced contrast",
"ordinalSeverity": 0,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
},
"excerpt": "THANK YOU!"
},
{
"ruleID": "r66",
"what": "Text outside widget has enhanced contrast",
"ordinalSeverity": 0,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]"
},
"excerpt": "Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
},
{
"ruleID": "r66",
"what": "Text outside widget has enhanced contrast",
"ordinalSeverity": 0,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]"
},
"excerpt": "-Joe Patterson"
},
{
"ruleID": "r66",
"what": "Text outside widget has enhanced contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[2]/div[1]/form[1]/div[6]/button[1]/span[1]/text()[1]"
},
"excerpt": "SUBMIT"
},
{
"ruleID": "r66",
"what": "Text outside widget has enhanced contrast",
"ordinalSeverity": 0,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
},
"excerpt": "Meet Joe Patterson"
},
{
"ruleID": "r66",
"what": "Text outside widget has enhanced contrast",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]"
},
"excerpt": "Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
},
{
"ruleID": "r69",
"what": "Text outside widget has minimum contrast",
"ordinalSeverity": 0,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
},
"excerpt": "THANK YOU!"
},
{
"ruleID": "r69",
"what": "Text outside widget has minimum contrast",
"ordinalSeverity": 0,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]/text()[1]"
},
"excerpt": "Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol."
},
{
"ruleID": "r69",
"what": "Text outside widget has minimum contrast",
"ordinalSeverity": 0,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]/span[1]/text()[1]"
},
"excerpt": "-Joe Patterson"
},
{
"ruleID": "r69",
"what": "Text outside widget has minimum contrast",
"ordinalSeverity": 0,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]/span[1]/text()[1]"
},
"excerpt": "Meet Joe Patterson"
},
{
"ruleID": "r69",
"what": "Text outside widget has minimum contrast",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]/text()[1]"
},
"excerpt": "Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, wor..."
},
{
"ruleID": "r71",
"what": "Paragraphs of text are not justified",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]"
},
"excerpt": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"> <span class=\"brz-cp-color3\"> Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span> </p>"
},
{
"ruleID": "r73",
"what": "Paragraphs of text have sufficient line height",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
},
"excerpt": "<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\"> <span class=\"brz-cp-color3\"> THANK YOU! </span> </p>"
},
{
"ruleID": "r73",
"what": "Paragraphs of text have sufficient line height",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]"
},
"excerpt": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"> <span class=\"brz-cp-color3\"> Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span> </p>"
},
{
"ruleID": "r73",
"what": "Paragraphs of text have sufficient line height",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]"
},
"excerpt": "<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\"> <span class=\"brz-cp-color3\"> -Joe Patterson </span> </p>"
},
{
"ruleID": "r73",
"what": "Paragraphs of text have sufficient line height",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
},
"excerpt": "<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\"> <span class=\"brz-cp-color1\"> Meet Joe Patterson </span> </p>"
},
{
"ruleID": "r74",
"what": "Paragraphs of text do not have font sizes defined in absolute units",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
},
"excerpt": "<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\"> <span class=\"brz-cp-color3\"> THANK YOU! </span> </p>"
},
{
"ruleID": "r74",
"what": "Paragraphs of text do not have font sizes defined in absolute units",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]"
},
"excerpt": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"> <span class=\"brz-cp-color3\"> Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span> </p>"
},
{
"ruleID": "r74",
"what": "Paragraphs of text do not have font sizes defined in absolute units",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[3]"
},
"excerpt": "<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\"> <span class=\"brz-cp-color3\"> -Joe Patterson </span> </p>"
},
{
"ruleID": "r74",
"what": "Paragraphs of text do not have font sizes defined in absolute units",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
},
"excerpt": "<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\"> <span class=\"brz-cp-color1\"> Meet Joe Patterson </span> </p>"
},
{
"ruleID": "r74",
"what": "Paragraphs of text do not have font sizes defined in absolute units",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]"
},
"excerpt": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\"> Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, w... </p>"
},
{
"ruleID": "r87",
"what": "First focusable element is link to main content",
"ordinalSeverity": 0,
"tagName": "",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/"
},
"excerpt": "#document <!doctype html> ... </html>"
}
]
},
"endTime": 1687099513397
},
{
"type": "test",
"which": "axe",
"detailLevel": 2,
"startTime": 1687099513397,
"url": "https://joepatterson.com/",
"what": "Axe",
"result": {
"totals": {
"rulesNA": 64,
"rulesPassed": 32,
"rulesWarned": 2,
"rulesViolated": 8,
"warnings": {
"minor": 13,
"moderate": 0,
"serious": 11,
"critical": 0
},
"violations": {
"minor": 2,
"moderate": 23,
"serious": 4,
"critical": 1
}
},
"details": {
"testEngine": {
"name": "axe-core",
"version": "4.7.0"
},
"testRunner": {
"name": "axe"
},
"testEnvironment": {
"userAgent": "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) HeadlessChrome/113.0.5672.53 Safari/537.36",
"windowWidth": 1280,
"windowHeight": 720,
"orientationAngle": 90,
"orientationType": "landscape-primary"
},
"timestamp": "2023-06-18T14:45:13.960Z",
"url": "https://joepatterson.com/",
"toolOptions": {
"resultTypes": [
"violations",
"incomplete"
],
"runOnly": {
"type": "tag",
"values": [
"experimental",
"best-practice",
"wcag2a",
"wcag2aa",
"wcag2aaa",
"wcag21a",
"wcag21aa",
"wcag21aaa"
]
},
"reporter": "v1"
},
"incomplete": [
{
"id": "color-contrast",
"impact": "serious",
"tags": [
"cat.color",
"wcag2aa",
"wcag143",
"ACT",
"TTv5",
"TT13.c"
],
"description": "Ensures the contrast between foreground and background colors meets WCAG 2 AA minimum contrast ratio thresholds",
"help": "Elements must meet minimum color contrast ratio thresholds",
"helpUrl": "https://dequeuniversity.com/rules/axe/4.7/color-contrast?application=axeAPI",
"nodes": [
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "34.5pt (46px)",
"fontWeight": "bold",
"messageKey": "bgGradient",
"expectedContrastRatio": "3:1"
},
"relatedNodes": [
{
"html": "<div class=\"brz-bg-color\"></div>",
"target": [
".brz-css-miyhv > .brz-bg > .brz-bg-color"
]
}
],
"impact": "serious",
"message": "Element's background color could not be determined due to a background gradient"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<span class=\"brz-cp-color3\">THANK YOU!</span>",
"target": [
".brz-css-mntwc > .brz-cp-color3"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined due to a background gradient"
},
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "21.0pt (28px)",
"fontWeight": "bold",
"messageKey": "elmPartiallyObscuring",
"expectedContrastRatio": "3:1"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element's background color could not be determined because it partially overlaps other elements"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>",
"target": [
".brz-css-aesxw > .brz-cp-color3"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined because it partially overlaps other elements"
},
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "21.0pt (28px)",
"fontWeight": "bold",
"messageKey": "bgGradient",
"expectedContrastRatio": "3:1"
},
"relatedNodes": [
{
"html": "<div class=\"brz-bg-color\"></div>",
"target": [
".brz-css-miyhv > .brz-bg > .brz-bg-color"
]
}
],
"impact": "serious",
"message": "Element's background color could not be determined due to a background gradient"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<span class=\"brz-cp-color3\">-Joe Patterson </span>",
"target": [
".brz-css-swhqo > .brz-cp-color3"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined due to a background gradient"
},
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "63.0pt (84px)",
"fontWeight": "bold",
"messageKey": "bgGradient",
"expectedContrastRatio": "3:1"
},
"relatedNodes": [
{
"html": "<div class=\"brz-bg-color\"></div>",
"target": [
".brz-css-miyhv > .brz-bg > .brz-bg-color"
]
}
],
"impact": "serious",
"message": "Element's background color could not be determined due to a background gradient"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>",
"target": [
".brz-css-lkuyo > strong"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined due to a background gradient"
},
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "33.0pt (44px)",
"fontWeight": "bold",
"messageKey": "bgOverlap",
"expectedContrastRatio": "3:1"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element's background color could not be determined because it is overlapped by another element"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>",
"target": [
".brz-scp-color2.brz-cp-color8"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined because it is overlapped by another element"
},
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "34.5pt (46px)",
"fontWeight": "bold",
"messageKey": "bgOverlap",
"expectedContrastRatio": "3:1"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element's background color could not be determined because it is overlapped by another element"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>",
"target": [
".brz-css-dbkfe > .brz-cp-color8"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined because it is overlapped by another element"
},
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "13.5pt (18px)",
"fontWeight": "bold",
"messageKey": "bgOverlap",
"expectedContrastRatio": "4.5:1"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element's background color could not be determined because it is overlapped by another element"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"target": [
"#jzrufgnrfzecnjmtttonuyghestufadxldym"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined because it is overlapped by another element"
},
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "13.5pt (18px)",
"fontWeight": "bold",
"messageKey": "bgOverlap",
"expectedContrastRatio": "4.5:1"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element's background color could not be determined because it is overlapped by another element"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"target": [
"#mclycssgwgofzkypsbsvkaswqtjdgpvowhhz"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined because it is overlapped by another element"
},
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "13.5pt (18px)",
"fontWeight": "bold",
"messageKey": "bgOverlap",
"expectedContrastRatio": "4.5:1"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element's background color could not be determined because it is overlapped by another element"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>",
"target": [
"#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined because it is overlapped by another element"
},
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "13.5pt (18px)",
"fontWeight": "bold",
"messageKey": "bgOverlap",
"expectedContrastRatio": "4.5:1"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element's background color could not be determined because it is overlapped by another element"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"target": [
"#oijylgskfpupythmpgcgqnojnxwotrblubel"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined because it is overlapped by another element"
},
{
"any": [
{
"id": "color-contrast",
"data": {
"contrastRatio": 0,
"fontSize": "13.5pt (18px)",
"fontWeight": "bold",
"messageKey": "bgOverlap",
"expectedContrastRatio": "4.5:1"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element's background color could not be determined because it is overlapped by another element"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"target": [
"#cbowzefbgrpgocofetojkemunbeanmiuuxiw"
],
"failureSummary": "Fix any of the following:\n Element's background color could not be determined because it is overlapped by another element"
}
]
},
{
"id": "hidden-content",
"impact": "minor",
"tags": [
"cat.structure",
"experimental",
"review-item",
"best-practice"
],
"description": "Informs users about hidden content.",
"help": "Hidden content on the page should be analyzed",
"helpUrl": "https://dequeuniversity.com/rules/axe/4.7/hidden-content?application=axeAPI",
"nodes": [
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<nav id=\"asmnvqfvmmootnluikvnozrkjelxspuhkucy\" class=\"brz-menu brz-menu__mmenu brz-menu--has-dropdown brz-menu__preview brz-css-fpfjx brz-css-wjjfv brz-mm-menu brz-mm-menu_offcanvas brz-mm-menu_theme-dark brz-mm-menu_pagedim-black brz-mm-menu_border-full brz-mm-menu_position-front brz-mm-menu_position-left\" aria-hidden=\"true\">",
"target": [
"#asmnvqfvmmootnluikvnozrkjelxspuhkucy"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<div id=\"mm-2\" class=\"brz-mm-panel brz-mm-hidden\" aria-hidden=\"true\">",
"target": [
"#mm-2"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22%2C%22tablet%22%3A%22bottom-start%22%2C%22mobile%22%3A%22bottom-start%22%7D%7D\" class=\"brz-menu__dropdown brz-menu__sub-menu\" style=\"--offset: 5px; position: absolute; inset: 0px auto auto 0px; margin: 0px; transform: translate(0px, 44px);\" data-popper-placement=\"bottom-start\">",
"target": [
"ul[data-popper-placement=\"bottom-start\"]"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<div class=\"brz-mm-menu__icon\">",
"target": [
".brz-mm-menu__icon"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<div class=\"brz-css-aebhg brz-css-qezxz brz-wrapper\">",
"target": [
".brz-css-qezxz"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-uyuor\" id=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-brz-popup=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-click_outside_to_close=\"true\" data-custom-id=\"ikypnpgzhasdbsxyczhyhiktepvcivqziwaf\">",
"target": [
"#wziehoicgkyratljhitjiidxmxjsagxhbsyb"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<section data-uid=\"dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq\" id=\"dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq\" class=\"brz-section brz-css-czgqm brz-css-dqvpp\">",
"target": [
"#dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
"target": [
"form[data-success=\"\"][data-error=\"\"][data-redirect=\"/confirmation/\"] > .brz-forms2__item-button.brz-forms2.brz-forms2__item > button > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
"target": [
".brz-css-dyvgx > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22%2C%22tablet%22%3A%22bottom-start%22%2C%22mobile%22%3A%22bottom-start%22%7D%7D\" class=\"brz-menu__dropdown brz-menu__sub-menu\" style=\"--offset: 5px; position: absolute; inset: auto auto 0px 0px; margin: 0px; transform: translate(0px, -43px);\" data-popper-reference-hidden=\"\" data-popper-escaped=\"\" data-popper-placement=\"top-start\">",
"target": [
"ul[data-popper-reference-hidden=\"\"]"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">",
"target": [
".brz-css-rplcf > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<div class=\"brz-mm-wrapper__blocker brz-mm-slideout\"><a href=\"#mm-0\"><span class=\"brz-mm-sronly\">Close menu</span></a></div>",
"target": [
".brz-mm-wrapper__blocker"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
},
{
"any": [
{
"id": "hidden-content",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-coyvp\" id=\"gfvfkzeiseiarwaanpeufzkocrfwprktavbj\" data-brz-popup=\"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-click_outside_to_close=\"true\" data-custom-id=\"zvpudqmsabbezjvlgveuzqjicfdsinhpicia\">",
"target": [
"#gfvfkzeiseiarwaanpeufzkocrfwprktavbj"
],
"failureSummary": "Fix any of the following:\n There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
}
]
}
],
"violations": [
{
"id": "color-contrast-enhanced",
"impact": "serious",
"tags": [
"cat.color",
"wcag2aaa",
"wcag146",
"ACT"
],
"description": "Ensures the contrast between foreground and background colors meets WCAG 2 AAA enhanced contrast ratio thresholds",
"help": "Elements must meet enhanced color contrast ratio thresholds",
"helpUrl": "https://dequeuniversity.com/rules/axe/4.7/color-contrast-enhanced?application=axeAPI",
"nodes": [
{
"any": [
{
"id": "color-contrast-enhanced",
"data": {
"fgColor": "#ffffff",
"bgColor": "#e1251b",
"contrastRatio": 4.68,
"fontSize": "11.3pt (15px)",
"fontWeight": "bold",
"messageKey": null,
"expectedContrastRatio": "7:1"
},
"relatedNodes": [
{
"html": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj\" data-custom-id=\"nxouluvbretczsumlwfttgzfltqnntvlwvaf\">",
"target": [
"form[data-success=\"\"][data-error=\"\"][data-redirect=\"/confirmation/\"] > .brz-forms2__item-button.brz-forms2.brz-forms2__item > button"
]
}
],
"impact": "serious",
"message": "Element has insufficient color contrast of 4.68 (foreground color: #ffffff, background color: #e1251b, font size: 11.3pt (15px), font weight: bold). Expected contrast ratio of 7:1"
}
],
"all": [],
"none": [],
"impact": "serious",
"html": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>",
"target": [
"form[data-success=\"\"][data-error=\"\"][data-redirect=\"/confirmation/\"] > .brz-forms2__item-button.brz-forms2.brz-forms2__item > button > .brz-text__editor.brz-span"
],
"failureSummary": "Fix any of the following:\n Element has insufficient color contrast of 4.68 (foreground color: #ffffff, background color: #e1251b, font size: 11.3pt (15px), font weight: bold). Expected contrast ratio of 7:1"
}
]
},
{
"id": "duplicate-id",
"impact": "minor",
"tags": [
"cat.parsing",
"wcag2a",
"wcag411"
],
"description": "Ensures every id attribute value is unique",
"help": "id attribute value must be unique",
"helpUrl": "https://dequeuniversity.com/rules/axe/4.7/duplicate-id?application=axeAPI",
"nodes": [
{
"any": [
{
"id": "duplicate-id",
"data": "close-popup",
"relatedNodes": [
{
"html": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">",
"target": [
".brz-css-jyuit > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"]"
]
}
],
"impact": "minor",
"message": "Document has multiple static elements with the same id attribute: close-popup"
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">",
"target": [
".brz-css-puutg > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"]"
],
"failureSummary": "Fix any of the following:\n Document has multiple static elements with the same id attribute: close-popup"
},
{
"any": [
{
"id": "duplicate-id",
"data": "Line-2",
"relatedNodes": [
{
"html": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
"target": [
".brz-css-puutg > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"] > path[stroke=\"currentColor\"][fill-rule=\"nonzero\"]:nth-child(2)"
]
},
{
"html": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
"target": [
".brz-css-jyuit > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"] > path[stroke=\"currentColor\"][fill-rule=\"nonzero\"]:nth-child(1)"
]
},
{
"html": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
"target": [
".brz-css-jyuit > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"] > path[stroke=\"currentColor\"][fill-rule=\"nonzero\"]:nth-child(2)"
]
}
],
"impact": "minor",
"message": "Document has multiple static elements with the same id attribute: Line-2"
}
],
"all": [],
"none": [],
"impact": "minor",
"html": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
"target": [
".brz-css-puutg > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"] > path[stroke=\"currentColor\"][fill-rule=\"nonzero\"]:nth-child(1)"
],
"failureSummary": "Fix any of the following:\n Document has multiple static elements with the same id attribute: Line-2"
}
]
},
{
"id": "image-alt",
"impact": "critical",
"tags": [
"cat.text-alternatives",
"wcag2a",
"wcag111",
"section508",
"section508.22.a",
"ACT",
"TTv5",
"TT7.a",
"TT7.b"
],
"description": "Ensures <img> elements have alternate text or a role of none or presentation",
"help": "Images must have alternate text",
"helpUrl": "https://dequeuniversity.com/rules/axe/4.7/image-alt?application=axeAPI",
"nodes": [
{
"any": [
{
"id": "has-alt",
"data": null,
"relatedNodes": [],
"impact": "critical",
"message": "Element does not have an alt attribute"
},
{
"id": "aria-label",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "aria-label attribute does not exist or is empty"
},
{
"id": "aria-labelledby",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty"
},
{
"id": "non-empty-title",
"data": {
"messageKey": "noAttr"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element has no title attribute"
},
{
"id": "presentational-role",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "Element's default semantics were not overridden with role=\"none\" or role=\"presentation\""
}
],
"all": [],
"none": [],
"impact": "critical",
"html": "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">",
"target": [
"img[width=\"1\"]"
],
"failureSummary": "Fix any of the following:\n Element does not have an alt attribute\n aria-label attribute does not exist or is empty\n aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty\n Element has no title attribute\n Element's default semantics were not overridden with role=\"none\" or role=\"presentation\""
}
]
},
{
"id": "landmark-one-main",
"impact": "moderate",
"tags": [
"cat.semantics",
"best-practice"
],
"description": "Ensures the document has a main landmark",
"help": "Document should have one main landmark",
"helpUrl": "https://dequeuniversity.com/rules/axe/4.7/landmark-one-main?application=axeAPI",
"nodes": [
{
"any": [],
"all": [
{
"id": "page-has-main",
"data": null,
"relatedNodes": [],
"impact": "moderate",
"message": "Document does not have a main landmark"
}
],
"none": [],
"impact": "moderate",
"html": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\">",
"target": [
"html"
],
"failureSummary": "Fix all of the following:\n Document does not have a main landmark"
}
]
},
{
"id": "landmark-unique",
"impact": "moderate",
"tags": [
"cat.semantics",
"best-practice"
],
"help": "Ensures landmarks are unique",
"description": "Landmarks should have a unique role or role/label/title (i.e. accessible name) combination",
"helpUrl": "https://dequeuniversity.com/rules/axe/4.7/landmark-unique?application=axeAPI",
"nodes": [
{
"any": [
{
"id": "landmark-is-unique",
"data": {
"role": "navigation",
"accessibleText": null
},
"relatedNodes": [
{
"html": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\">",
"target": [
".brz-css-hasdy"
]
}
],
"impact": "moderate",
"message": "The landmark must have a unique aria-label, aria-labelledby, or title to make landmarks distinguishable"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\">",
"target": [
".brz-css-nxfqt > .brz-css-wjjfv"
],
"failureSummary": "Fix any of the following:\n The landmark must have a unique aria-label, aria-labelledby, or title to make landmarks distinguishable"
}
]
},
{
"id": "link-name",
"impact": "serious",
"tags": [
"cat.name-role-value",
"wcag2a",
"wcag412",
"wcag244",
"section508",
"section508.22.a",
"ACT",
"TTv5",
"TT6.a"
],
"description": "Ensures links have discernible text",
"help": "Links must have discernible text",
"helpUrl": "https://dequeuniversity.com/rules/axe/4.7/link-name?application=axeAPI",
"nodes": [
{
"any": [
{
"id": "has-visible-text",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "Element does not have text that is visible to screen readers"
},
{
"id": "aria-label",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "aria-label attribute does not exist or is empty"
},
{
"id": "aria-labelledby",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty"
},
{
"id": "non-empty-title",
"data": {
"messageKey": "noAttr"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element has no title attribute"
}
],
"all": [],
"none": [
{
"id": "focusable-no-name",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "Element is in tab order and does not have accessible text"
}
],
"impact": "serious",
"html": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\">",
"target": [
".brz-css-yauhe > .brz-a[href$=\"joepatterson.com/\"][data-brz-link-type=\"external\"]"
],
"failureSummary": "Fix all of the following:\n Element is in tab order and does not have accessible text\n\nFix any of the following:\n Element does not have text that is visible to screen readers\n aria-label attribute does not exist or is empty\n aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty\n Element has no title attribute"
},
{
"any": [
{
"id": "has-visible-text",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "Element does not have text that is visible to screen readers"
},
{
"id": "aria-label",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "aria-label attribute does not exist or is empty"
},
{
"id": "aria-labelledby",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty"
},
{
"id": "non-empty-title",
"data": {
"messageKey": "noAttr"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element has no title attribute"
}
],
"all": [],
"none": [
{
"id": "focusable-no-name",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "Element is in tab order and does not have accessible text"
}
],
"impact": "serious",
"html": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
"target": [
"#gucekfcwzkwvwbcfqjgrflyvigkonlxuvqdd > .brz-icon__container > .brz-a[target=\"_blank\"][rel=\"noopener\"]"
],
"failureSummary": "Fix all of the following:\n Element is in tab order and does not have accessible text\n\nFix any of the following:\n Element does not have text that is visible to screen readers\n aria-label attribute does not exist or is empty\n aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty\n Element has no title attribute"
},
{
"any": [
{
"id": "has-visible-text",
"data": null,
"relatedNodes": [],
"impact": "minor",
"message": "Element does not have text that is visible to screen readers"
},
{
"id": "aria-label",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "aria-label attribute does not exist or is empty"
},
{
"id": "aria-labelledby",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty"
},
{
"id": "non-empty-title",
"data": {
"messageKey": "noAttr"
},
"relatedNodes": [],
"impact": "serious",
"message": "Element has no title attribute"
}
],
"all": [],
"none": [
{
"id": "focusable-no-name",
"data": null,
"relatedNodes": [],
"impact": "serious",
"message": "Element is in tab order and does not have accessible text"
}
],
"impact": "serious",
"html": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">",
"target": [
"a[href$=\"Patterdude\"]"
],
"failureSummary": "Fix all of the following:\n Element is in tab order and does not have accessible text\n\nFix any of the following:\n Element does not have text that is visible to screen readers\n aria-label attribute does not exist or is empty\n aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty\n Element has no title attribute"
}
]
},
{
"id": "page-has-heading-one",
"impact": "moderate",
"tags": [
"cat.semantics",
"best-practice"
],
"description": "Ensure that the page, or at least one of its frames contains a level-one heading",
"help": "Page should contain a level-one heading",
"helpUrl": "https://dequeuniversity.com/rules/axe/4.7/page-has-heading-one?application=axeAPI",
"nodes": [
{
"any": [],
"all": [
{
"id": "page-has-heading-one",
"data": null,
"relatedNodes": [],
"impact": "moderate",
"message": "Page must have a level-one heading"
}
],
"none": [],
"impact": "moderate",
"html": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\">",
"target": [
"html"
],
"failureSummary": "Fix all of the following:\n Page must have a level-one heading"
}
]
},
{
"id": "region",
"impact": "moderate",
"tags": [
"cat.keyboard",
"best-practice"
],
"description": "Ensures all page content is contained by landmarks",
"help": "All page content should be contained by landmarks",
"helpUrl": "https://dequeuniversity.com/rules/axe/4.7/region?application=axeAPI",
"nodes": [
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">",
"target": [
"img[width=\"1\"]"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-columns brz-css-pnewc brz-css-vjmzn\" data-custom-id=\"vwsaahrlenirosxrtdqzxlalcydssbntmwui\">",
"target": [
".brz-css-vjmzn"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<span class=\"brz-span brz-text__editor\">DONATE</span>",
"target": [
".brz-css-xufry > .brz-text__editor.brz-span"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-columns brz-css-pnewc brz-css-llegy\" data-custom-id=\"xhhnllzgngskrjccgozmqvlbgjhmedgxajds\">",
"target": [
".brz-css-llegy"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-css-aebhg brz-css-lmjol brz-wrapper\">",
"target": [
".brz-css-lmjol"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-css-aebhg brz-css-yfpby brz-wrapper\">",
"target": [
".brz-css-yfpby"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<section data-uid=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" id=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" class=\"brz-section brz-css-czgqm\">",
"target": [
"#tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-columns brz-css-pnewc brz-css-jqfpe\" data-custom-id=\"yntkcgpmtcucqxkadnufyxwattcvnlhgeohq\">",
"target": [
".brz-css-jqfpe"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-css-aebhg brz-css-ybzgg brz-wrapper\">",
"target": [
".brz-css-ybzgg"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-gjenq\">",
"target": [
".brz-css-gjenq"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-sqjjw\">",
"target": [
".brz-css-sqjjw"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk\">",
"target": [
".brz-css-pmcfe.brz-css-umcxw.brz-css-liimk:nth-child(3)"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-solsx\">",
"target": [
".brz-css-solsx"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-xnabq\">",
"target": [
".brz-css-xnabq"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<section data-uid=\"nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag\" id=\"nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag\" class=\"brz-section brz-css-czgqm brz-css-bnzyh\">",
"target": [
"#nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-css-aebhg brz-wrapper\">",
"target": [
".brz-css-bxfnb > .brz-css-aebhg.brz-wrapper:nth-child(1)"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-ilwyl\">",
"target": [
".brz-css-ilwyl"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-odtpn\">",
"target": [
".brz-css-odtpn"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-fyenv\">",
"target": [
".brz-css-fyenv"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
},
{
"any": [
{
"id": "region",
"data": {
"isIframe": false
},
"relatedNodes": [],
"impact": "moderate",
"message": "Some page content is not contained by landmarks"
}
],
"all": [],
"none": [],
"impact": "moderate",
"html": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-cbrxq\">",
"target": [
".brz-css-cbrxq"
],
"failureSummary": "Fix any of the following:\n Some page content is not contained by landmarks"
}
]
}
]
},
"success": true
},
"standardResult": {
"totals": [
13,
11,
25,
5
],
"instances": [
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined due to a background gradient",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-mntwc > .brz-cp-color3"
},
"excerpt": "<span class=\"brz-cp-color3\">THANK YOU!</span>"
},
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it partially overlaps other elements",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-aesxw > .brz-cp-color3"
},
"excerpt": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>"
},
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined due to a background gradient",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-swhqo > .brz-cp-color3"
},
"excerpt": "<span class=\"brz-cp-color3\">-Joe Patterson </span>"
},
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined due to a background gradient",
"ordinalSeverity": 1,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-lkuyo > strong"
},
"excerpt": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>"
},
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-scp-color2.brz-cp-color8"
},
"excerpt": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>"
},
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-dbkfe > .brz-cp-color8"
},
"excerpt": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>"
},
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#jzrufgnrfzecnjmtttonuyghestufadxldym"
},
"excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#mclycssgwgofzkypsbsvkaswqtjdgpvowhhz"
},
"excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx"
},
"excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>"
},
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#oijylgskfpupythmpgcgqnojnxwotrblubel"
},
"excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "color-contrast",
"what": "Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#cbowzefbgrpgocofetojkemunbeanmiuuxiw"
},
"excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "NAV",
"id": "asmnvqfvmmootnluikvnozrkjelxspuhkucy",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#asmnvqfvmmootnluikvnozrkjelxspuhkucy"
},
"excerpt": "<nav id=\"asmnvqfvmmootnluikvnozrkjelxspuhkucy\" class=\"brz-menu brz-menu__mmenu brz-menu--has-dropdown brz-menu__preview brz-css-fpfjx brz-css-wjjfv brz-mm-menu brz-mm-menu_offcanvas brz-mm-menu_theme-dark brz-mm-menu_pagedim-black brz-mm-menu_border-full brz-mm-menu_position-front brz-mm-menu_position-left\" aria-hidden=\"true\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "mm-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#mm-2"
},
"excerpt": "<div id=\"mm-2\" class=\"brz-mm-panel brz-mm-hidden\" aria-hidden=\"true\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "ul[data-popper-placement=\"bottom-start\"]"
},
"excerpt": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22% ... \" class=\"brz-menu__dropdown brz-menu__sub-menu\" style=\"--offset: 5px; position: absolute; inset: 0px auto auto 0px; margin: 0px; transform: translate(0px, 44px);\" data-popper-placement=\"bottom-start\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-mm-menu__icon"
},
"excerpt": "<div class=\"brz-mm-menu__icon\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-qezxz"
},
"excerpt": "<div class=\"brz-css-aebhg brz-css-qezxz brz-wrapper\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "wziehoicgkyratljhitjiidxmxjsagxhbsyb",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#wziehoicgkyratljhitjiidxmxjsagxhbsyb"
},
"excerpt": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-uyuor\" id=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-brz-popup=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-click_outside_to_close=\"true\" data-custom-id=\"ikypnpgzhasdbsxyczhyhiktepvcivqziwaf\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "SECTION",
"id": "dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq"
},
"excerpt": "<section data-uid=\"dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq\" id=\"dlpfxzhdcpryhkxbvbqkpjladopxhkuqvcxq\" class=\"brz-section brz-css-czgqm brz-css-dqvpp\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "form[data-success=\"\"][data-error=\"\"][data-redirect=\"/confirmation/\"] > .brz-forms2__item-button.brz-forms2.brz-forms2__item > button > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
},
"excerpt": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-dyvgx > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
},
"excerpt": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "ul[data-popper-reference-hidden=\"\"]"
},
"excerpt": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22% ... =\"--offset: 5px; position: absolute; inset: auto auto 0px 0px; margin: 0px; transform: translate(0px, -43px);\" data-popper-reference-hidden=\"\" data-popper-escaped=\"\" data-popper-placement=\"top-start\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-rplcf > .brz-form-spinner.brz-invisible.brz-ed-animated--spin"
},
"excerpt": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-form-spinner brz-invisible brz-ed-animated--spin\" data-type=\"glyph\" data-name=\"circle-02\">"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-mm-wrapper__blocker"
},
"excerpt": "<div class=\"brz-mm-wrapper__blocker brz-mm-slideout\"><a href=\"#mm-0\"><span class=\"brz-mm-sronly\">Close menu</span></a></div>"
},
{
"ruleID": "hidden-content",
"what": "Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "gfvfkzeiseiarwaanpeufzkocrfwprktavbj",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#gfvfkzeiseiarwaanpeufzkocrfwprktavbj"
},
"excerpt": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-coyvp\" id=\"gfvfkzeiseiarwaanpeufzkocrfwprktavbj\" data-brz-popup=\"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-click_outside_to_close=\"true\" data-custom-id=\"zvpudqmsabbezjvlgveuzqjicfdsinhpicia\">"
},
{
"ruleID": "color-contrast-enhanced",
"what": "Elements must meet enhanced color contrast ratio thresholds; Element has insufficient color contrast of 4.68 (foreground color: #ffffff, background color: #e1251b, font size: 11.3pt (15px), font weight: bold). Expected contrast ratio of 7:1",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "form[data-success=\"\"][data-error=\"\"][data-redirect=\"/confirmation/\"] > .brz-forms2__item-button.brz-forms2.brz-forms2__item > button > .brz-text__editor.brz-span"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>"
},
{
"ruleID": "duplicate-id",
"what": "id attribute value must be unique; Document has multiple static elements with the same id attribute: close-popup",
"ordinalSeverity": 2,
"tagName": "G",
"id": "close-popup",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-puutg > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"]"
},
"excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">"
},
{
"ruleID": "duplicate-id",
"what": "id attribute value must be unique; Document has multiple static elements with the same id attribute: Line-2",
"ordinalSeverity": 2,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-puutg > .brz-container__wrap > .brz-popup2__close > svg[data-name=\"close-popup\"][viewBox=\"0 0 16 16\"][data-type=\"editor\"] > g[stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"] > path[stroke=\"currentColor\"][fill-rule=\"nonzero\"]:nth-child(1)"
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
},
{
"ruleID": "image-alt",
"what": "Images must have alternate text; Element does not have an alt attribute; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute; Element's default semantics were not overridden with role=\"none\" or role=\"presentation\"",
"ordinalSeverity": 3,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "img[width=\"1\"]"
},
"excerpt": "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">"
},
{
"ruleID": "landmark-one-main",
"what": "Document should have one main landmark; Document does not have a main landmark",
"ordinalSeverity": 2,
"tagName": "HTML",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html"
},
"excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\">"
},
{
"ruleID": "landmark-unique",
"what": "Ensures landmarks are unique; The landmark must have a unique aria-label, aria-labelledby, or title to make landmarks distinguishable",
"ordinalSeverity": 2,
"tagName": "NAV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-nxfqt > .brz-css-wjjfv"
},
"excerpt": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\">"
},
{
"ruleID": "link-name",
"what": "Links must have discernible text; Element does not have text that is visible to screen readers; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-yauhe > .brz-a[href$=\"joepatterson.com/\"][data-brz-link-type=\"external\"]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\">"
},
{
"ruleID": "link-name",
"what": "Links must have discernible text; Element does not have text that is visible to screen readers; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#gucekfcwzkwvwbcfqjgrflyvigkonlxuvqdd > .brz-icon__container > .brz-a[target=\"_blank\"][rel=\"noopener\"]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">"
},
{
"ruleID": "link-name",
"what": "Links must have discernible text; Element does not have text that is visible to screen readers; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "a[href$=\"Patterdude\"]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">"
},
{
"ruleID": "page-has-heading-one",
"what": "Page should contain a level-one heading; Page must have a level-one heading",
"ordinalSeverity": 2,
"tagName": "HTML",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html"
},
"excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "img[width=\"1\"]"
},
"excerpt": "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-vjmzn"
},
"excerpt": "<div class=\"brz-columns brz-css-pnewc brz-css-vjmzn\" data-custom-id=\"vwsaahrlenirosxrtdqzxlalcydssbntmwui\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-xufry > .brz-text__editor.brz-span"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">DONATE</span>"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-llegy"
},
"excerpt": "<div class=\"brz-columns brz-css-pnewc brz-css-llegy\" data-custom-id=\"xhhnllzgngskrjccgozmqvlbgjhmedgxajds\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-lmjol"
},
"excerpt": "<div class=\"brz-css-aebhg brz-css-lmjol brz-wrapper\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-yfpby"
},
"excerpt": "<div class=\"brz-css-aebhg brz-css-yfpby brz-wrapper\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "SECTION",
"id": "tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq"
},
"excerpt": "<section data-uid=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" id=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" class=\"brz-section brz-css-czgqm\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-jqfpe"
},
"excerpt": "<div class=\"brz-columns brz-css-pnewc brz-css-jqfpe\" data-custom-id=\"yntkcgpmtcucqxkadnufyxwattcvnlhgeohq\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-ybzgg"
},
"excerpt": "<div class=\"brz-css-aebhg brz-css-ybzgg brz-wrapper\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-gjenq"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-gjenq\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-sqjjw"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-sqjjw\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-pmcfe.brz-css-umcxw.brz-css-liimk:nth-child(3)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-solsx"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-solsx\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-xnabq"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-xnabq\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "SECTION",
"id": "nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag",
"location": {
"doc": "dom",
"type": "selector",
"spec": "#nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag"
},
"excerpt": "<section data-uid=\"nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag\" id=\"nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag\" class=\"brz-section brz-css-czgqm brz-css-bnzyh\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-bxfnb > .brz-css-aebhg.brz-wrapper:nth-child(1)"
},
"excerpt": "<div class=\"brz-css-aebhg brz-wrapper\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-ilwyl"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-ilwyl\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-odtpn"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-odtpn\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-fyenv"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-fyenv\">"
},
{
"ruleID": "region",
"what": "All page content should be contained by landmarks; Some page content is not contained by landmarks",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": ".brz-css-cbrxq"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-cbrxq\">"
}
]
},
"endTime": 1687099513993
},
{
"type": "launch",
"which": "chromium",
"startTime": 1687099513994,
"endTime": 1687099514618
},
{
"type": "url",
"which": "https://joepatterson.com/",
"what": "Candidate Joe Patterson (R)",
"startTime": 1687099514619,
"result": {
"url": "https://joepatterson.com/"
},
"endTime": 1687099515487
},
{
"type": "test",
"which": "continuum",
"startTime": 1687099515487,
"url": "https://joepatterson.com/",
"what": "Level Access Continuum, community edition",
"result": [
{
"engineTestId": 89,
"bestPracticeId": 362,
"attribute": "This img element does not have a mechanism that allows an accessible name value to be calculated",
"attributeDetail": "This img element does not have a mechanism that allows an accessible name value to be calculated",
"element": "<img height=\"1\" width=\"1\" src=\"http://ib.adnxs.com/seg?add=30067132&t=2\">",
"path": "body>img:nth-of-type(1)",
"fingerprint": {
"version": 2,
"css": "img[src=\"http://ib.adnxs.com/seg?add=30067132&t=2\"][width=\"1\"][height=\"1\"]",
"attNo": 3
}
},
{
"engineTestId": 94,
"bestPracticeId": 1352,
"attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
"attributeDetail": "This g has an id attribute of 'close-popup', which is not unique in the same DOM",
"element": "<g stroke-linecap=\"square\" fill-rule=\"evenodd\" fill=\"none\" stroke-width=\"1\" stroke=\"none\" id=\"close-popup\"><path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.538404 ... path><path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path></g>",
"path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "g[id=\"close-popup\"][stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"][fill-rule=\"evenodd\"][stroke-linecap=\"square\"]",
"attNo": 6
}
},
{
"engineTestId": 94,
"bestPracticeId": 1352,
"attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
"attributeDetail": "This g has an id attribute of 'close-popup', which is not unique in the same DOM",
"element": "<g stroke-linecap=\"square\" fill-rule=\"evenodd\" fill=\"none\" stroke-width=\"1\" stroke=\"none\" id=\"close-popup\"><path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.538404 ... path><path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path></g>",
"path": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "g[id=\"close-popup\"][stroke=\"none\"][stroke-width=\"1\"][fill=\"none\"][fill-rule=\"evenodd\"][stroke-linecap=\"square\"]",
"attNo": 6
}
},
{
"engineTestId": 94,
"bestPracticeId": 1352,
"attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
"attributeDetail": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
"element": "<path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>",
"path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "path[d=\"M1.5,1.5 L14.5384048,14.5384048\"][id=\"Line-2\"][stroke=\"currentColor\"][fill-rule=\"nonzero\"]",
"attNo": 4
}
},
{
"engineTestId": 94,
"bestPracticeId": 1352,
"attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
"attributeDetail": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
"element": "<path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>",
"path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)",
"fingerprint": {
"version": 2,
"css": "path[d=\"M1.5,1.5 L14.5384048,14.5384048\"][id=\"Line-2\"][stroke=\"currentColor\"][fill-rule=\"nonzero\"][transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"]",
"attNo": 5
}
},
{
"engineTestId": 94,
"bestPracticeId": 1352,
"attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
"attributeDetail": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
"element": "<path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>",
"path": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "path[d=\"M1.5,1.5 L14.5384048,14.5384048\"][id=\"Line-2\"][stroke=\"currentColor\"][fill-rule=\"nonzero\"]",
"attNo": 4
}
},
{
"engineTestId": 94,
"bestPracticeId": 1352,
"attribute": "This element has an id attribute set to a value that is not unique in the same DOM",
"attributeDetail": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
"element": "<path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>",
"path": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)",
"fingerprint": {
"version": 2,
"css": "path[d=\"M1.5,1.5 L14.5384048,14.5384048\"][id=\"Line-2\"][stroke=\"currentColor\"][fill-rule=\"nonzero\"][transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"]",
"attNo": 5
}
},
{
"engineTestId": 123,
"bestPracticeId": 362,
"attribute": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"attributeDetail": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"element": "<svg data-name=\"tail-right\" data-type=\"glyph\" class=\"brz-icon-svg brz-css-oheuj\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w ... r\"><path d=\"M22.707,11.293L15,3.586L13.586,5l6,6H2c-0.553,0-1,0.448-1,1s0.447,1,1,1h17.586l-6,6L15,20.414 l7.707-7.707C23.098,12.316,23.098,11.684,22.707,11.293z\" fill=\"currentColor\"></path></g></svg>",
"path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "svg[version=\"1.1\"][x=\"0px\"][y=\"0px\"][viewbox=\"0 0 24 24\"][class=\"brz-icon-svg brz-css-oheuj\"][data-type=\"glyph\"][data-name=\"tail-right\"]",
"attNo": 10
}
},
{
"engineTestId": 123,
"bestPracticeId": 362,
"attribute": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"attributeDetail": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"element": "<svg data-name=\"quote-left\" data-type=\"fa\" class=\"brz-icon-svg\" viewbox=\"0 0 512 512\" xmlns=\"http://www.w3.org/2000/svg\"><path d=\"M464 256h-80v-64c0-35.3 28.7-64 64-64h8c13.3 0 24-10.7 24-24V56c0-13.3 ... 8zm-288 0H96v-64c0-35.3 28.7-64 64-64h8c13.3 0 24-10.7 24-24V56c0-13.3-10.7-24-24-24h-8C71.6 32 0 103.6 0 192v240c0 26.5 21.5 48 48 48h128c26.5 0 48-21.5 48-48V304c0-26.5-21.5-48-48-48z\"></path></svg>",
"path": "body>div:nth-of-type(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "svg[viewbox=\"0 0 512 512\"][class=\"brz-icon-svg\"][data-type=\"fa\"][data-name=\"quote-left\"]",
"attNo": 5
}
},
{
"engineTestId": 123,
"bestPracticeId": 362,
"attribute": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"attributeDetail": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"element": "<svg data-name=\"quote-right\" data-type=\"fa\" class=\"brz-icon-svg\" viewbox=\"0 0 512 512\" xmlns=\"http://www.w3.org/2000/svg\"><path d=\"M464 32H336c-26.5 0-48 21.5-48 48v128c0 26.5 21.5 48 48 48h80v64c0 35 ... 48zm-288 0H48C21.5 32 0 53.5 0 80v128c0 26.5 21.5 48 48 48h80v64c0 35.3-28.7 64-64 64h-8c-13.3 0-24 10.7-24 24v48c0 13.3 10.7 24 24 24h8c88.4 0 160-71.6 160-160V80c0-26.5-21.5-48-48-48z\"></path></svg>",
"path": "body>div:nth-of-type(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "svg[viewbox=\"0 0 512 512\"][class=\"brz-icon-svg\"][data-type=\"fa\"][data-name=\"quote-right\"]",
"attNo": 5
}
},
{
"engineTestId": 123,
"bestPracticeId": 362,
"attribute": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"attributeDetail": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"element": "<svg data-name=\"logo-facebook\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/ ... -4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\" fill=\"currentColor\"></path></g></svg>",
"path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "svg[version=\"1.1\"][x=\"0px\"][y=\"0px\"][viewbox=\"0 0 24 24\"][class=\"brz-icon-svg\"][data-type=\"glyph\"][data-name=\"logo-facebook\"]",
"attNo": 10
}
},
{
"engineTestId": 123,
"bestPracticeId": 362,
"attribute": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"attributeDetail": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"element": "<svg data-name=\"logo-twitter\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/s ... -0.1c0.6,2,2.4,3.4,4.6,3.4 c-1.7,1.3-3.8,2.1-6.1,2.1c-0.4,0-0.8,0-1.2-0.1c2.2,1.4,4.8,2.2,7.5,2.2c9.1,0,14-7.5,14-14c0-0.2,0-0.4,0-0.6 C22.5,6.4,23.3,5.5,24,4.6z\" fill=\"currentColor\"></path></g></svg>",
"path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "svg[version=\"1.1\"][x=\"0px\"][y=\"0px\"][viewbox=\"0 0 24 24\"][class=\"brz-icon-svg\"][data-type=\"glyph\"][data-name=\"logo-twitter\"]",
"attNo": 10
}
},
{
"engineTestId": 237,
"bestPracticeId": 1301,
"attribute": "This A element does not have a mechanism that allows an accessible name value to be calculated",
"attributeDetail": "This A element does not have a mechanism that allows an accessible name value to be calculated",
"element": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\"><picture class=\"brz-picture brz-d-block brz-p-relative brz-c ... z-css-ptqop\"><img loading=\"lazy\" draggable=\"false\" alt=\"\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" class=\"brz-img brz-img-svg\" decoding=\"async\"></picture></a>",
"path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "a[class=\"brz-a\"][href=\"https://joepatterson.com/\"][data-brz-link-type=\"external\"][id=\"\"][data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"]",
"attNo": 5
}
},
{
"engineTestId": 237,
"bestPracticeId": 1301,
"attribute": "This A element does not have a mechanism that allows an accessible name value to be calculated",
"attributeDetail": "This A element does not have a mechanism that allows an accessible name value to be calculated",
"element": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\"><span class=\"brz-span brz-icon css-1yqt0eo\"><svg data-name=\"log ... 25,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\" fill=\"currentColor\"></path></g></svg></span></a>",
"path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "a[class=\"brz-a\"][href=\"https://www.facebook.com/PattersonForAssembly\"][target=\"_blank\"][rel=\"noopener\"][data-brz-link-type=\"external\"][id=\"\"]",
"attNo": 6
}
},
{
"engineTestId": 237,
"bestPracticeId": 1301,
"attribute": "This A element does not have a mechanism that allows an accessible name value to be calculated",
"attributeDetail": "This A element does not have a mechanism that allows an accessible name value to be calculated",
"element": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\"><span class=\"brz-span brz-icon css-1ldonqd\"><svg data-name=\"logo-twitter\" data ... 2.4,3.4,4.6,3.4 c-1.7,1.3-3.8,2.1-6.1,2.1c-0.4,0-0.8,0-1.2-0.1c2.2,1.4,4.8,2.2,7.5,2.2c9.1,0,14-7.5,14-14c0-0.2,0-0.4,0-0.6 C22.5,6.4,23.3,5.5,24,4.6z\" fill=\"currentColor\"></path></g></svg></span></a>",
"path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "a[class=\"brz-a\"][href=\"https://twitter.com/Patterdude\"][target=\"_blank\"][rel=\"noopener\"][data-brz-link-type=\"external\"][id=\"\"]",
"attNo": 6
}
},
{
"engineTestId": 531,
"bestPracticeId": 2519,
"attribute": "This nav does not have a unique accessible name as required when two or more nav elements are present",
"attributeDetail": "This nav does not have a unique accessible name as required when two or more nav elements are present",
"element": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>",
"path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "nav[class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"]",
"attNo": 1
}
},
{
"engineTestId": 531,
"bestPracticeId": 2519,
"attribute": "This nav does not have a unique accessible name as required when two or more nav elements are present",
"attributeDetail": "This nav does not have a unique accessible name as required when two or more nav elements are present",
"element": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>",
"path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "nav[class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"]",
"attNo": 1
}
},
{
"engineTestId": 533,
"bestPracticeId": 2519,
"attribute": "This nav does not have an accessible name as required when two or more nav elements are present",
"attributeDetail": "This nav does not have an accessible name as required when two or more nav elements are present",
"element": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>",
"path": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "nav[class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"]",
"attNo": 1
}
},
{
"engineTestId": 533,
"bestPracticeId": 2519,
"attribute": "This nav does not have an accessible name as required when two or more nav elements are present",
"attributeDetail": "This nav does not have an accessible name as required when two or more nav elements are present",
"element": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>",
"path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "nav[class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"]",
"attNo": 1
}
},
{
"engineTestId": 863,
"bestPracticeId": 2440,
"attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
"attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
"element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"First Name*\" data-label=\"First Name*\" data-type=\"Text\" required=\"\" placeholder=\"First Name*\" name=\"esdduiuzvslnnwyiw ... eholder=\"First Name*\" data-label=\"First Name*\" data-type=\"Text\" required=\"\" placeholder=\"First Name*\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" type=\"text\">",
"path": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "input[type=\"text\"][id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\"][name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\"][placeholder=\"First Name*\"][required=\"\"][data-type=\"Text\"][data-label=\"First Name*\"][data-placeholder=\"First Name*\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
"attNo": 9
}
},
{
"engineTestId": 863,
"bestPracticeId": 2440,
"attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
"attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
"element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Last Name*\" data-label=\"Last Name*\" data-type=\"Text\" required=\"\" placeholder=\"Last Name*\" name=\"rzfsrryoylspdpgnjcau ... laceholder=\"Last Name*\" data-label=\"Last Name*\" data-type=\"Text\" required=\"\" placeholder=\"Last Name*\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" type=\"text\">",
"path": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "input[type=\"text\"][id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\"][name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\"][placeholder=\"Last Name*\"][required=\"\"][data-type=\"Text\"][data-label=\"Last Name*\"][data-placeholder=\"Last Name*\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
"attNo": 9
}
},
{
"engineTestId": 863,
"bestPracticeId": 2440,
"attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
"attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
"element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email *\" data-label=\"Email *\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@" ... ,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email *\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" type=\"email\">",
"path": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "input[type=\"email\"][id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\"][name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\"][placeholder=\"Email *\"][required=\"\"][pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@\\\"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@\\\"]+)*)|(\\\".+\\\"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\"][data-type=\"Email\"][data-label=\"Email *\"][data-placeholder=\"Email *\"][class=\"brz-input brz-forms2__field brz-forms2__field-email\"]",
"attNo": 10
}
},
{
"engineTestId": 863,
"bestPracticeId": 2440,
"attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
"attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
"element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Cell Phone\" data-label=\"Cell Phone\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone\" name=\"uffubxyvtwxroutxldwp ... laceholder=\"Cell Phone\" data-label=\"Cell Phone\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" type=\"text\">",
"path": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(4)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "input[type=\"text\"][id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\"][name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\"][placeholder=\"Cell Phone\"][required=\"\"][data-type=\"Text\"][data-label=\"Cell Phone\"][data-placeholder=\"Cell Phone\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
"attNo": 9
}
},
{
"engineTestId": 863,
"bestPracticeId": 2440,
"attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
"attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
"element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Zip\" data-label=\"Zip\" data-type=\"Text\" required=\"\" placeholder=\"Zip\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" id= ... 2__field-text\" data-placeholder=\"Zip\" data-label=\"Zip\" data-type=\"Text\" required=\"\" placeholder=\"Zip\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" type=\"text\">",
"path": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(5)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "input[type=\"text\"][id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\"][name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\"][placeholder=\"Zip\"][required=\"\"][data-type=\"Text\"][data-label=\"Zip\"][data-placeholder=\"Zip\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
"attNo": 9
}
},
{
"engineTestId": 863,
"bestPracticeId": 2440,
"attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
"attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
"element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Name*\" data-label=\"Name*\" data-type=\"Text\" required=\"\" placeholder=\"Name*\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnm ... ld-text\" data-placeholder=\"Name*\" data-label=\"Name*\" data-type=\"Text\" required=\"\" placeholder=\"Name*\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" type=\"text\">",
"path": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "input[type=\"text\"][id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\"][name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\"][placeholder=\"Name*\"][required=\"\"][data-type=\"Text\"][data-label=\"Name*\"][data-placeholder=\"Name*\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
"attNo": 9
}
},
{
"engineTestId": 863,
"bestPracticeId": 2440,
"attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
"attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
"element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Title*\" data-label=\"Title*\" data-type=\"Text\" required=\"\" placeholder=\"Title*\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlv ... text\" data-placeholder=\"Title*\" data-label=\"Title*\" data-type=\"Text\" required=\"\" placeholder=\"Title*\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" type=\"text\">",
"path": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "input[type=\"text\"][id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\"][name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\"][placeholder=\"Title*\"][required=\"\"][data-type=\"Text\"][data-label=\"Title*\"][data-placeholder=\"Title*\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
"attNo": 9
}
},
{
"engineTestId": 863,
"bestPracticeId": 2440,
"attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
"attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
"element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email*\" data-label=\"Email*\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+ ... 1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email*\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" type=\"email\">",
"path": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "input[type=\"email\"][id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\"][name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\"][placeholder=\"Email*\"][required=\"\"][pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@\\\"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@\\\"]+)*)|(\\\".+\\\"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\"][data-type=\"Email\"][data-label=\"Email*\"][data-placeholder=\"Email*\"][class=\"brz-input brz-forms2__field brz-forms2__field-email\"]",
"attNo": 10
}
},
{
"engineTestId": 863,
"bestPracticeId": 2440,
"attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
"attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
"element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Cell Phone*\" data-label=\"Cell Phone*\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone*\" name=\"oluhpiqjxgvcswhkq ... eholder=\"Cell Phone*\" data-label=\"Cell Phone*\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone*\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" type=\"text\">",
"path": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(4)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "input[type=\"text\"][id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\"][name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\"][placeholder=\"Cell Phone*\"][required=\"\"][data-type=\"Text\"][data-label=\"Cell Phone*\"][data-placeholder=\"Cell Phone*\"][class=\"brz-input brz-forms2__field brz-forms2__field-text\"]",
"attNo": 9
}
},
{
"engineTestId": 863,
"bestPracticeId": 2440,
"attribute": "This input should not rely on text in the placeholder attribute for an accessible name",
"attributeDetail": "This input should not rely on text in the placeholder attribute for an accessible name",
"element": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email Updates\" data-label=\"Email Updates\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\. ... 0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email Updates\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" type=\"email\">",
"path": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)",
"fingerprint": {
"version": 2,
"css": "input[type=\"email\"][id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\"][name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\"][placeholder=\"Email Updates\"][required=\"\"][pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@\\\"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@\\\"]+)*)|(\\\".+\\\"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\"][data-type=\"Email\"][data-label=\"Email Updates\"][data-placeholder=\"Email Updates\"][class=\"brz-input brz-forms2__field brz-forms2__field-email\"]",
"attNo": 10
}
}
],
"standardResult": {
"totals": [
0,
0,
0,
29
],
"instances": [
{
"ruleID": "89",
"what": "This img element does not have a mechanism that allows an accessible name value to be calculated",
"ordinalSeverity": 3,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>img:nth-of-type(1)"
},
"excerpt": "<img height=\"1\" width=\"1\" src=\"http://ib.adnxs.com/seg?add=30067132&t=2\">"
},
{
"ruleID": "94",
"what": "This g has an id attribute of 'close-popup', which is not unique in the same DOM",
"ordinalSeverity": 3,
"tagName": "G",
"id": "close-popup",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<g stroke-linecap=\"square\" fill-rule=\"evenodd\" fill=\"none\" stroke-width=\"1\" stroke=\"none\" id=\"close-popup\"><path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.538404 ... path><path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path></g>"
},
{
"ruleID": "94",
"what": "This g has an id attribute of 'close-popup', which is not unique in the same DOM",
"ordinalSeverity": 3,
"tagName": "G",
"id": "close-popup",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<g stroke-linecap=\"square\" fill-rule=\"evenodd\" fill=\"none\" stroke-width=\"1\" stroke=\"none\" id=\"close-popup\"><path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.538404 ... path><path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path></g>"
},
{
"ruleID": "94",
"what": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>"
},
{
"ruleID": "94",
"what": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)"
},
"excerpt": "<path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>"
},
{
"ruleID": "94",
"what": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<path fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>"
},
{
"ruleID": "94",
"what": "This path has an id attribute of 'Line-2', which is not unique in the same DOM",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)"
},
"excerpt": "<path transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \" fill-rule=\"nonzero\" stroke=\"currentColor\" id=\"Line-2\" d=\"M1.5,1.5 L14.5384048,14.5384048\"></path>"
},
{
"ruleID": "123",
"what": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"ordinalSeverity": 3,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<svg data-name=\"tail-right\" data-type=\"glyph\" class=\"brz-icon-svg brz-css-oheuj\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w ... r\"><path d=\"M22.707,11.293L15,3.586L13.586,5l6,6H2c-0.553,0-1,0.448-1,1s0.447,1,1,1h17.586l-6,6L15,20.414 l7.707-7.707C23.098,12.316,23.098,11.684,22.707,11.293z\" fill=\"currentColor\"></path></g></svg>"
},
{
"ruleID": "123",
"what": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"ordinalSeverity": 3,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<svg data-name=\"quote-left\" data-type=\"fa\" class=\"brz-icon-svg\" viewbox=\"0 0 512 512\" xmlns=\"http://www.w3.org/2000/svg\"><path d=\"M464 256h-80v-64c0-35.3 28.7-64 64-64h8c13.3 0 24-10.7 24-24V56c0-13.3 ... 8zm-288 0H96v-64c0-35.3 28.7-64 64-64h8c13.3 0 24-10.7 24-24V56c0-13.3-10.7-24-24-24h-8C71.6 32 0 103.6 0 192v240c0 26.5 21.5 48 48 48h128c26.5 0 48-21.5 48-48V304c0-26.5-21.5-48-48-48z\"></path></svg>"
},
{
"ruleID": "123",
"what": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"ordinalSeverity": 3,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<svg data-name=\"quote-right\" data-type=\"fa\" class=\"brz-icon-svg\" viewbox=\"0 0 512 512\" xmlns=\"http://www.w3.org/2000/svg\"><path d=\"M464 32H336c-26.5 0-48 21.5-48 48v128c0 26.5 21.5 48 48 48h80v64c0 35 ... 48zm-288 0H48C21.5 32 0 53.5 0 80v128c0 26.5 21.5 48 48 48h80v64c0 35.3-28.7 64-64 64h-8c-13.3 0-24 10.7-24 24v48c0 13.3 10.7 24 24 24h8c88.4 0 160-71.6 160-160V80c0-26.5-21.5-48-48-48z\"></path></svg>"
},
{
"ruleID": "123",
"what": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"ordinalSeverity": 3,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<svg data-name=\"logo-facebook\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/ ... -4.788 c1.325,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\" fill=\"currentColor\"></path></g></svg>"
},
{
"ruleID": "123",
"what": "This svg element does not have a mechanism that allows an accessible name value to be calculated",
"ordinalSeverity": 3,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<svg data-name=\"logo-twitter\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewbox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/s ... -0.1c0.6,2,2.4,3.4,4.6,3.4 c-1.7,1.3-3.8,2.1-6.1,2.1c-0.4,0-0.8,0-1.2-0.1c2.2,1.4,4.8,2.2,7.5,2.2c9.1,0,14-7.5,14-14c0-0.2,0-0.4,0-0.6 C22.5,6.4,23.3,5.5,24,4.6z\" fill=\"currentColor\"></path></g></svg>"
},
{
"ruleID": "237",
"what": "This A element does not have a mechanism that allows an accessible name value to be calculated",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\"><picture class=\"brz-picture brz-d-block brz-p-relative brz-c ... z-css-ptqop\"><img loading=\"lazy\" draggable=\"false\" alt=\"\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" class=\"brz-img brz-img-svg\" decoding=\"async\"></picture></a>"
},
{
"ruleID": "237",
"what": "This A element does not have a mechanism that allows an accessible name value to be calculated",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\"><span class=\"brz-span brz-icon css-1yqt0eo\"><svg data-name=\"log ... 25,0,2.463,0.099,2.795,0.143v3.24l-1.918,0.001c-1.504,0-1.795,0.715-1.795,1.763V11h4.44l-1,4h-3.44v9H22c1.105,0,2-0.895,2-2 V2C24,0.895,23.105,0,22,0z\" fill=\"currentColor\"></path></g></svg></span></a>"
},
{
"ruleID": "237",
"what": "This A element does not have a mechanism that allows an accessible name value to be calculated",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\"><span class=\"brz-span brz-icon css-1ldonqd\"><svg data-name=\"logo-twitter\" data ... 2.4,3.4,4.6,3.4 c-1.7,1.3-3.8,2.1-6.1,2.1c-0.4,0-0.8,0-1.2-0.1c2.2,1.4,4.8,2.2,7.5,2.2c9.1,0,14-7.5,14-14c0-0.2,0-0.4,0-0.6 C22.5,6.4,23.3,5.5,24,4.6z\" fill=\"currentColor\"></path></g></svg></span></a>"
},
{
"ruleID": "531",
"what": "This nav does not have a unique accessible name as required when two or more nav elements are present",
"ordinalSeverity": 3,
"tagName": "NAV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>"
},
{
"ruleID": "531",
"what": "This nav does not have a unique accessible name as required when two or more nav elements are present",
"ordinalSeverity": 3,
"tagName": "NAV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>"
},
{
"ruleID": "533",
"what": "This nav does not have an accessible name as required when two or more nav elements are present",
"ordinalSeverity": 3,
"tagName": "NAV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-wjjfv\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>"
},
{
"ruleID": "533",
"what": "This nav does not have an accessible name as required when two or more nav elements are present",
"ordinalSeverity": 3,
"tagName": "NAV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<nav class=\"brz-menu brz-menu__preview brz-css-fpfjx brz-css-hasdy\"><ul data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\" class=\"brz-menu__ul\"><li data-menu-item-id=\"b80377d0ea164df79e92847fe9 ... \"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\"><span class=\"brz-span\">Issues</span></a></li></ul></nav>"
},
{
"ruleID": "863",
"what": "This input should not rely on text in the placeholder attribute for an accessible name",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"First Name*\" data-label=\"First Name*\" data-type=\"Text\" required=\"\" placeholder=\"First Name*\" name=\"esdduiuzvslnnwyiw ... eholder=\"First Name*\" data-label=\"First Name*\" data-type=\"Text\" required=\"\" placeholder=\"First Name*\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" type=\"text\">"
},
{
"ruleID": "863",
"what": "This input should not rely on text in the placeholder attribute for an accessible name",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)"
},
"excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Last Name*\" data-label=\"Last Name*\" data-type=\"Text\" required=\"\" placeholder=\"Last Name*\" name=\"rzfsrryoylspdpgnjcau ... laceholder=\"Last Name*\" data-label=\"Last Name*\" data-type=\"Text\" required=\"\" placeholder=\"Last Name*\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" type=\"text\">"
},
{
"ruleID": "863",
"what": "This input should not rely on text in the placeholder attribute for an accessible name",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)"
},
"excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email *\" data-label=\"Email *\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@" ... ,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email *\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" type=\"email\">"
},
{
"ruleID": "863",
"what": "This input should not rely on text in the placeholder attribute for an accessible name",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(4)>*:nth-child(1)"
},
"excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Cell Phone\" data-label=\"Cell Phone\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone\" name=\"uffubxyvtwxroutxldwp ... laceholder=\"Cell Phone\" data-label=\"Cell Phone\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" type=\"text\">"
},
{
"ruleID": "863",
"what": "This input should not rely on text in the placeholder attribute for an accessible name",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(6)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(2)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(5)>*:nth-child(1)"
},
"excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Zip\" data-label=\"Zip\" data-type=\"Text\" required=\"\" placeholder=\"Zip\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" id= ... 2__field-text\" data-placeholder=\"Zip\" data-label=\"Zip\" data-type=\"Text\" required=\"\" placeholder=\"Zip\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" type=\"text\">"
},
{
"ruleID": "863",
"what": "This input should not rely on text in the placeholder attribute for an accessible name",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Name*\" data-label=\"Name*\" data-type=\"Text\" required=\"\" placeholder=\"Name*\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnm ... ld-text\" data-placeholder=\"Name*\" data-label=\"Name*\" data-type=\"Text\" required=\"\" placeholder=\"Name*\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" type=\"text\">"
},
{
"ruleID": "863",
"what": "This input should not rely on text in the placeholder attribute for an accessible name",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)"
},
"excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Title*\" data-label=\"Title*\" data-type=\"Text\" required=\"\" placeholder=\"Title*\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlv ... text\" data-placeholder=\"Title*\" data-label=\"Title*\" data-type=\"Text\" required=\"\" placeholder=\"Title*\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" type=\"text\">"
},
{
"ruleID": "863",
"what": "This input should not rely on text in the placeholder attribute for an accessible name",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(3)>*:nth-child(1)"
},
"excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email*\" data-label=\"Email*\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+ ... 1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email*\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" type=\"email\">"
},
{
"ruleID": "863",
"what": "This input should not rely on text in the placeholder attribute for an accessible name",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(8)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(4)>*:nth-child(1)"
},
"excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-text\" data-placeholder=\"Cell Phone*\" data-label=\"Cell Phone*\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone*\" name=\"oluhpiqjxgvcswhkq ... eholder=\"Cell Phone*\" data-label=\"Cell Phone*\" data-type=\"Text\" required=\"\" placeholder=\"Cell Phone*\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" type=\"text\">"
},
{
"ruleID": "863",
"what": "This input should not rely on text in the placeholder attribute for an accessible name",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"location": {
"doc": "dom",
"type": "selector",
"spec": "body>div:nth-of-type(1)>*:nth-child(9)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(2)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)>*:nth-child(1)"
},
"excerpt": "<input class=\"brz-input brz-forms2__field brz-forms2__field-email\" data-placeholder=\"Email Updates\" data-label=\"Email Updates\" data-type=\"Email\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\. ... 0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" required=\"\" placeholder=\"Email Updates\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" type=\"email\">"
}
]
},
"endTime": 1687099515878
},
{
"type": "launch",
"which": "chromium",
"startTime": 1687099515878,
"endTime": 1687099516487
},
{
"type": "url",
"which": "https://joepatterson.com/",
"what": "Candidate Joe Patterson (R)",
"startTime": 1687099516487,
"result": {
"url": "https://joepatterson.com/"
},
"endTime": 1687099517402
},
{
"type": "test",
"which": "htmlcs",
"startTime": 1687099517402,
"url": "https://joepatterson.com/",
"what": "HTML CodeSniffer WCAG 2.1 AA ruleset",
"result": {
"Error": {
"AAA.1_1_1.H37": {
"Img element missing an alt attribute. Use the alt attribute to specify a short text alternative.": [
{
"tagName": "img",
"id": "",
"code": "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">"
}
]
},
"AAA.1_3_1.F68": {
"This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.": [
{
"tagName": "input",
"id": "#cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"code": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"code": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#jzrufgnrfzecnjmtttonuyghestufadxldym",
"code": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"code": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#oijylgskfpupythmpgcgqnojnxwotrblubel",
"code": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"code": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"code": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
}
]
},
"AAA.1_4_6.G17.Fail": {
"This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #595959.": [
{
"tagName": "span",
"id": "",
"code": "<span class=\"brz-cp-color8 brz-pre-population-visible\">...</span>"
},
{
"tagName": "span",
"id": "",
"code": "<span class=\"brz-cp-color8\">...</span>"
}
],
"This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 4.69:1. Recommendation: change background to #b40900.": [
{
"tagName": "span",
"id": "",
"code": "<span class=\"brz-span brz-text__editor\">...</span>"
}
]
},
"AAA.1_4_6.G18.Fail": {
"This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #767676.": [
{
"tagName": "span",
"id": "",
"code": "<span class=\"brz-cp-color8\">...</span>"
},
{
"tagName": "span",
"id": "",
"code": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">...</span>"
},
{
"tagName": "span",
"id": "",
"code": "<span class=\"brz-span\">...</span>"
},
{
"tagName": "strong",
"id": "",
"code": "<strong class=\"brz-cp-color8\">...</strong>"
},
{
"tagName": "strong",
"id": "",
"code": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">...</strong>"
}
]
},
"AAA.2_4_1.G1,G123,G124.NoSuchID": {
"This link points to a named anchor \"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" within the document, but no anchor exists with that name.": [
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\">...</a>"
}
]
},
"AAA.2_4_8.H59.1": {
"Link elements can only be located in the head section of the document.": [
{
"tagName": "link",
"id": "",
"code": "<link class=\"brz-link brz-link-google-preconnect\" rel=\"preconnect\" href=\"https://fonts.gstatic.com/\" crossorigin=\"\">"
},
{
"tagName": "link",
"id": "",
"code": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//ajax.googleapis.com\">"
},
{
"tagName": "link",
"id": "",
"code": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">"
},
{
"tagName": "link",
"id": "",
"code": "<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\">"
},
{
"tagName": "link",
"id": "",
"code": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\">"
},
{
"tagName": "link",
"id": "",
"code": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\">"
}
]
},
"AAA.4_1_1.F77": {
"Duplicate id attribute value \"close-popup\" found on the web page.": [
{
"tagName": "g",
"id": "#close-popup",
"code": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">...</g>"
}
],
"Duplicate id attribute value \"Line-2\" found on the web page.": [
{
"tagName": "path",
"id": "#Line-2",
"code": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \">...</path>"
},
{
"tagName": "path",
"id": "#Line-2",
"code": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\">...</path>"
}
]
},
"AAA.4_1_2.H91.A.NoContent": {
"Anchor element found with a valid href attribute, but no link content has been supplied.": [
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
}
]
},
"AAA.4_1_2.H91.InputEmail.Name": {
"This emailinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.": [
{
"tagName": "input",
"id": "#chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"code": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)"
},
{
"tagName": "input",
"id": "#mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"code": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)"
},
{
"tagName": "input",
"id": "#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"code": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)"
}
]
},
"AAA.4_1_2.H91.InputText.Name": {
"This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.": [
{
"tagName": "input",
"id": "#cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"code": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"code": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#jzrufgnrfzecnjmtttonuyghestufadxldym",
"code": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"code": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#oijylgskfpupythmpgcgqnojnxwotrblubel",
"code": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"code": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"tagName": "input",
"id": "#xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"code": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
}
]
}
},
"Warning": {
"AAA.1_1_1.H67.2": {
"Img element is marked so that it is ignored by Assistive Technology.": [
{
"tagName": "img",
"id": "",
"code": "<img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_RedWhite.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
},
{
"tagName": "img",
"id": "",
"code": "<img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
},
{
"tagName": "img",
"id": "",
"code": "<img decoding=\"async\" class=\"brz-img\" srcset=\"https://joepatterson.com/wp-content/uploads/brizy/imgs/14138876_1728728670722916_1937653619668703721_o_1728728670722916-588x392x0x19x470x307x1641332718.jpg 1x, https://joepatterson.com/wp-content/uploads/brizy/imgs/14138876_1728728670722916_1937653619668703721_o_1728728670722916-1176x784x0x38x940x614x1641332718.jpg 2x\" src=\"https://joepatterson.com/wp-content/uploads/brizy/imgs/14138876_1728728670722916_1937653619668703721_o_1728728670722916-960x640x0x0x960x627x1641332718.jpg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
}
]
},
"AAA.1_3_1.H42": {
"Heading markup should be used if this content is intended as a heading.": [
{
"tagName": "p",
"id": "",
"code": "<p class=\"brz-css-bklfk\" data-uniq-id=\"qxpfh\" data-generated-css=\"brz-css-owucl\">...</p>"
},
{
"tagName": "p",
"id": "",
"code": "<p class=\"brz-css-lkuyo\" data-generated-css=\"brz-css-kokqw\" data-uniq-id=\"hpxfi\">...</p>"
}
]
},
"AAA.1_4_10.C32,C31,C33,C38,SCR34,G206": {
"This element has \"position: fixed\". This may require scrolling in two dimensions, which is considered a failure of this Success Criterion.": [
{
"tagName": "div",
"id": "#gfvfkzeiseiarwaanpeufzkocrfwprktavbj",
"code": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-coyvp\" id=\"gfvfkzeiseiarwaanpeufzkocrfwprktavbj\" data-brz-popup=\"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-click_outside_to_close=\"true\" data-custom-id=\"zvpudqmsabbezjvlgveuzqjicfdsinhpicia\">...</div>"
},
{
"tagName": "div",
"id": "#wziehoicgkyratljhitjiidxmxjsagxhbsyb",
"code": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-uyuor\" id=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-brz-popup=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-click_outside_to_close=\"true\" data-custom-id=\"ikypnpgzhasdbsxyczhyhiktepvcivqziwaf\">...</div>"
},
{
"tagName": "div",
"id": "",
"code": "<div class=\"brz-mm-wrapper__blocker brz-mm-slideout\">...</div>"
}
]
},
"AAA.1_4_3_F24.F24.FGColour": {
"Check that this element has an inherited background colour or image to complement the corresponding inline foreground colour.": [
{
"tagName": "strong",
"id": "",
"code": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">...</strong>"
}
]
},
"AAA.3_2_5.H83.3": {
"Check that this link's link text contains information indicating that the link will open in a new window.": [
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-cbllz\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yemcvnewgngfymiotxewwyjzajhaeldnceah\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdggtybzbtscl\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurwjvjsywyumae\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufznyxypipympv\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
},
{
"tagName": "a",
"id": "",
"code": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
}
]
}
},
"success": true
},
"standardResult": {
"totals": [
22,
0,
0,
39
],
"instances": [
{
"ruleID": "AAA.1_1_1.H67.2",
"what": "Img element is marked so that it is ignored by Assistive Technology.",
"ordinalSeverity": 0,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_RedWhite.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
},
{
"ruleID": "AAA.1_1_1.H67.2",
"what": "Img element is marked so that it is ignored by Assistive Technology.",
"ordinalSeverity": 0,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<img decoding=\"async\" class=\"brz-img brz-img-svg\" src=\"https://joepatterson.com/wp-content/uploads/2022/01/Patterson_Logo_White.svg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
},
{
"ruleID": "AAA.1_1_1.H67.2",
"what": "Img element is marked so that it is ignored by Assistive Technology.",
"ordinalSeverity": 0,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<img decoding=\"async\" class=\"brz-img\" srcset=\"https://joepatterson.com/wp-content/uploads/brizy/imgs/14138876_1728728670722916_1937653619668703721_o_1728728670722916-588x392x0x19x470x307x1641332718.jp ... rc=\"https://joepatterson.com/wp-content/uploads/brizy/imgs/14138876_1728728670722916_1937653619668703721_o_1728728670722916-960x640x0x0x960x627x1641332718.jpg\" alt=\"\" draggable=\"false\" loading=\"lazy\">"
},
{
"ruleID": "AAA.1_3_1.H42",
"what": "Heading markup should be used if this content is intended as a heading.",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<p class=\"brz-css-bklfk\" data-uniq-id=\"qxpfh\" data-generated-css=\"brz-css-owucl\">...</p>"
},
{
"ruleID": "AAA.1_3_1.H42",
"what": "Heading markup should be used if this content is intended as a heading.",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<p class=\"brz-css-lkuyo\" data-generated-css=\"brz-css-kokqw\" data-uniq-id=\"hpxfi\">...</p>"
},
{
"ruleID": "AAA.1_4_10.C32,C31,C33,C38,SCR34,G206",
"what": "This element has \"position: fixed\". This may require scrolling in two dimensions, which is considered a failure of this Success Criterion.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "gfvfkzeiseiarwaanpeufzkocrfwprktavbj",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-coyvp\" id=\"gfvfkzeiseiarwaanpeufzkocrfwprktavbj\" data-brz-popup=\"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-click_outside_to_close=\"true\" data-custom-id=\"zvpudqmsabbezjvlgveuzqjicfdsinhpicia\">...</div>"
},
{
"ruleID": "AAA.1_4_10.C32,C31,C33,C38,SCR34,G206",
"what": "This element has \"position: fixed\". This may require scrolling in two dimensions, which is considered a failure of this Success Criterion.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "wziehoicgkyratljhitjiidxmxjsagxhbsyb",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-uyuor\" id=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-brz-popup=\"wziehoicgkyratljhitjiidxmxjsagxhbsyb\" data-click_outside_to_close=\"true\" data-custom-id=\"ikypnpgzhasdbsxyczhyhiktepvcivqziwaf\">...</div>"
},
{
"ruleID": "AAA.1_4_10.C32,C31,C33,C38,SCR34,G206",
"what": "This element has \"position: fixed\". This may require scrolling in two dimensions, which is considered a failure of this Success Criterion.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-mm-wrapper__blocker brz-mm-slideout\">...</div>"
},
{
"ruleID": "AAA.1_4_3_F24.F24.FGColour",
"what": "Check that this element has an inherited background colour or image to complement the corresponding inline foreground colour.",
"ordinalSeverity": 0,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">...</strong>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-cbllz\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yemcvnewgngfymiotxewwyjzajhaeldnceah\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdggtybzbtscl\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurwjvjsywyumae\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufznyxypipympv\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
},
{
"ruleID": "AAA.3_2_5.H83.3",
"what": "Check that this link's link text contains information indicating that the link will open in a new window.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
},
{
"ruleID": "AAA.1_1_1.H37",
"what": "Img element missing an alt attribute. Use the alt attribute to specify a short text alternative.",
"ordinalSeverity": 3,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">"
},
{
"ruleID": "AAA.1_3_1.F68",
"what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.1_3_1.F68",
"what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.1_3_1.F68",
"what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.1_3_1.F68",
"what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.1_3_1.F68",
"what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.1_3_1.F68",
"what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.1_3_1.F68",
"what": "This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.1_4_6.G17.Fail",
"what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #595959.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<span class=\"brz-cp-color8 brz-pre-population-visible\">...</span>"
},
{
"ruleID": "AAA.1_4_6.G17.Fail",
"what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #595959.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<span class=\"brz-cp-color8\">...</span>"
},
{
"ruleID": "AAA.1_4_6.G17.Fail",
"what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 4.69:1. Recommendation: change background to #b40900.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<span class=\"brz-span brz-text__editor\">...</span>"
},
{
"ruleID": "AAA.1_4_6.G18.Fail",
"what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #767676.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<span class=\"brz-cp-color8\">...</span>"
},
{
"ruleID": "AAA.1_4_6.G18.Fail",
"what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #767676.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">...</span>"
},
{
"ruleID": "AAA.1_4_6.G18.Fail",
"what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #767676.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<span class=\"brz-span\">...</span>"
},
{
"ruleID": "AAA.1_4_6.G18.Fail",
"what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #767676.",
"ordinalSeverity": 3,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<strong class=\"brz-cp-color8\">...</strong>"
},
{
"ruleID": "AAA.1_4_6.G18.Fail",
"what": "This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #767676.",
"ordinalSeverity": 3,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">...</strong>"
},
{
"ruleID": "AAA.2_4_1.G1,G123,G124.NoSuchID",
"what": "This link points to a named anchor \"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" within the document, but no anchor exists with that name.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\">...</a>"
},
{
"ruleID": "AAA.2_4_8.H59.1",
"what": "Link elements can only be located in the head section of the document.",
"ordinalSeverity": 3,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<link class=\"brz-link brz-link-google-preconnect\" rel=\"preconnect\" href=\"https://fonts.gstatic.com/\" crossorigin=\"\">"
},
{
"ruleID": "AAA.2_4_8.H59.1",
"what": "Link elements can only be located in the head section of the document.",
"ordinalSeverity": 3,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//ajax.googleapis.com\">"
},
{
"ruleID": "AAA.2_4_8.H59.1",
"what": "Link elements can only be located in the head section of the document.",
"ordinalSeverity": 3,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">"
},
{
"ruleID": "AAA.2_4_8.H59.1",
"what": "Link elements can only be located in the head section of the document.",
"ordinalSeverity": 3,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\">"
},
{
"ruleID": "AAA.2_4_8.H59.1",
"what": "Link elements can only be located in the head section of the document.",
"ordinalSeverity": 3,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\">"
},
{
"ruleID": "AAA.2_4_8.H59.1",
"what": "Link elements can only be located in the head section of the document.",
"ordinalSeverity": 3,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\">"
},
{
"ruleID": "AAA.4_1_1.F77",
"what": "Duplicate id attribute value \"close-popup\" found on the web page.",
"ordinalSeverity": 3,
"tagName": "G",
"id": "close-popup",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\">...</g>"
},
{
"ruleID": "AAA.4_1_1.F77",
"what": "Duplicate id attribute value \"Line-2\" found on the web page.",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \">...</path>"
},
{
"ruleID": "AAA.4_1_1.F77",
"what": "Duplicate id attribute value \"Line-2\" found on the web page.",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\">...</path>"
},
{
"ruleID": "AAA.4_1_2.H91.A.NoContent",
"what": "Anchor element found with a valid href attribute, but no link content has been supplied.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\">...</a>"
},
{
"ruleID": "AAA.4_1_2.H91.A.NoContent",
"what": "Anchor element found with a valid href attribute, but no link content has been supplied.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
},
{
"ruleID": "AAA.4_1_2.H91.A.NoContent",
"what": "Anchor element found with a valid href attribute, but no link content has been supplied.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\">...</a>"
},
{
"ruleID": "AAA.4_1_2.H91.InputEmail.Name",
"what": "This emailinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)"
},
{
"ruleID": "AAA.4_1_2.H91.InputEmail.Name",
"what": "This emailinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)"
},
{
"ruleID": "AAA.4_1_2.H91.InputEmail.Name",
"what": "This emailinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)"
},
{
"ruleID": "AAA.4_1_2.H91.InputText.Name",
"what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.4_1_2.H91.InputText.Name",
"what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.4_1_2.H91.InputText.Name",
"what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.4_1_2.H91.InputText.Name",
"what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.4_1_2.H91.InputText.Name",
"what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.4_1_2.H91.InputText.Name",
"what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "AAA.4_1_2.H91.InputText.Name",
"what": "This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute.",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"location": {
"doc": "dom",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
}
]
},
"endTime": 1687099517666
},
{
"type": "launch",
"which": "chromium",
"startTime": 1687099517666,
"endTime": 1687099518280
},
{
"type": "url",
"which": "https://joepatterson.com/",
"what": "Candidate Joe Patterson (R)",
"startTime": 1687099518280,
"result": {
"url": "https://joepatterson.com/"
},
"endTime": 1687099519417
},
{
"type": "test",
"which": "ibm",
"withItems": true,
"withNewContent": false,
"startTime": 1687099519417,
"url": "https://joepatterson.com/",
"what": "IBM Accessibility Checker",
"result": {
"totals": {
"violation": 43,
"recommendation": 5,
"ignored": 0
},
"items": [
{
"ruleId": "img_alt_valid",
"path": {
"dom": "/html[1]/body[1]/img[1]",
"aria": "/document[1]/img[1]"
},
"message": "The image has neither an alt atttribute nor an ARIA label or title",
"bounds": {
"left": 0,
"top": 14,
"height": 1,
"width": 1
},
"snippet": "<img height=\"1\" width=\"1\" src=\"http://ib.adnxs.com/seg?add=30067132&t=2\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]",
"aria": "/document[1]/link[14]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 328,
"top": 1915,
"height": 54,
"width": 146
},
"snippet": "<a data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\" id=\"\" data-brz-link-type=\"external\" href=\"/about/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]",
"aria": "/document[1]/link[13]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 580,
"top": 765,
"height": 54,
"width": 113
},
"snippet": "<a data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]",
"aria": "/document[1]/link[12]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 484,
"top": 765,
"height": 54,
"width": 86
},
"snippet": "<a data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]",
"aria": "/document[1]/link[11]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 386,
"top": 765,
"height": 54,
"width": 88
},
"snippet": "<a data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]",
"aria": "/document[1]/link[10]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 289,
"top": 765,
"height": 54,
"width": 88
},
"snippet": "<a data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]",
"aria": "/document[1]/link[9]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 195,
"top": 765,
"height": 54,
"width": 85
},
"snippet": "<a data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]",
"aria": "/document[1]/link[8]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 108,
"top": 765,
"height": 54,
"width": 77
},
"snippet": "<a data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[3]/div[1]/div[1]/div[1]/div[1]/div[1]",
"aria": "/document[1]"
},
"message": "The <div> element has the id \"\" that is empty",
"bounds": {
"left": 742,
"top": 225,
"height": 48,
"width": 48
},
"snippet": "<div data-custom-id=\"muserakcqcfkwarzkttrfzizvtktwtqbysti\" class=\"brz-icon__container\" id=\"\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]",
"aria": "/document[1]"
},
"message": "The <div> element has the id \"\" that is empty",
"bounds": {
"left": 11,
"top": 225,
"height": 48,
"width": 48
},
"snippet": "<div data-custom-id=\"axlyrxgtqqbwisbspsmpehfdbsksrzxgfgii\" class=\"brz-icon__container\" id=\"\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]",
"aria": "/document[1]/link[3]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 498,
"top": 84,
"height": 54,
"width": 150
},
"snippet": "<a data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]",
"aria": "/document[1]/link[2]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 459,
"top": 86,
"height": 48,
"width": 48
},
"snippet": "<a id=\"\" data-brz-link-type=\"popup\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" class=\"brz-a\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]",
"aria": "/document[1]"
},
"message": "The <div> element has the id \"\" that is empty",
"bounds": {
"left": 459,
"top": 86,
"height": 48,
"width": 48
},
"snippet": "<div data-custom-id=\"pceqxnmehonwogvnkufwatiazpvvrypiilwr\" class=\"brz-icon__container\" id=\"\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"aria": "/document[1]/link[1]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 42,
"top": 56,
"height": 109,
"width": 284
},
"snippet": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
"aria": "/document[1]/contentinfo[1]/link[2]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 414,
"top": 2629,
"height": 19,
"width": 32
},
"snippet": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]",
"aria": "/document[1]/contentinfo[1]"
},
"message": "The <div> element has the id \"\" that is empty",
"bounds": {
"left": 414,
"top": 2625,
"height": 32,
"width": 32
},
"snippet": "<div data-custom-id=\"nzkalizvyqxpxwhmghgfojzckegcabnhnsiw\" class=\"brz-icon__container\" id=\"\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"aria": "/document[1]/contentinfo[1]/link[1]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 354,
"top": 2629,
"height": 19,
"width": 32
},
"snippet": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]",
"aria": "/document[1]/contentinfo[1]"
},
"message": "The <div> element has the id \"\" that is empty",
"bounds": {
"left": 354,
"top": 2625,
"height": 32,
"width": 32
},
"snippet": "<div data-custom-id=\"gucekfcwzkwvwbcfqjgrflyvigkonlxuvqdd\" class=\"brz-icon__container\" id=\"\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]",
"aria": "/document[1]/contentinfo[1]/navigation[1]/list[1]/listitem[5]/link[1]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 509,
"top": 2499,
"height": 28,
"width": 60
},
"snippet": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]",
"aria": "/document[1]/contentinfo[1]/navigation[1]/list[1]/listitem[4]/link[1]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 454,
"top": 2499,
"height": 28,
"width": 45
},
"snippet": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/ad5/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]",
"aria": "/document[1]/contentinfo[1]/navigation[1]/list[1]/listitem[3]/link[1]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 392,
"top": 2499,
"height": 28,
"width": 53
},
"snippet": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/news/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]",
"aria": "/document[1]/contentinfo[1]/navigation[1]/list[1]/listitem[2]/link[1]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 299,
"top": 2499,
"height": 28,
"width": 83
},
"snippet": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/about/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">",
"level": "violation"
},
{
"ruleId": "element_id_unique",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]",
"aria": "/document[1]/contentinfo[1]/navigation[1]/list[1]/listitem[1]/link[1]"
},
"message": "The <a> element has the id \"\" that is empty",
"bounds": {
"left": 233,
"top": 2499,
"height": 28,
"width": 57
},
"snippet": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
"aria": "/document[1]/paragraph[13]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 30,
"top": 2098,
"height": 84,
"width": 740
},
"snippet": "<p data-generated-css=\"brz-css-owucl\" data-uniq-id=\"qxpfh\" class=\"brz-css-bklfk\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]",
"aria": "/document[1]/link[14]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 328,
"top": 1915,
"height": 54,
"width": 146
},
"snippet": "<a data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\" id=\"\" data-brz-link-type=\"external\" href=\"/about/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]",
"aria": "/document[1]/paragraph[12]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 30,
"top": 1775,
"height": 120,
"width": 740
},
"snippet": "<p data-generated-css=\"brz-css-eyoug\" data-uniq-id=\"mdupv\" class=\"brz-css-bnogt\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
"aria": "/document[1]/paragraph[11]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 30,
"top": 1683,
"height": 73,
"width": 740
},
"snippet": "<p data-uniq-id=\"ssqmz\" data-generated-css=\"brz-css-fyurj\" class=\"brz-css-nhelt\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[1]/div[1]/div[1]/p[1]",
"aria": "/document[1]/paragraph[10]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 52,
"top": 1343,
"height": 46,
"width": 696
},
"snippet": "<p class=\"brz-css-dbkfe\" data-generated-css=\"brz-css-owosm\" data-uniq-id=\"hwwdz\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]",
"aria": "/document[1]/link[13]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 580,
"top": 765,
"height": 54,
"width": 113
},
"snippet": "<a data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]",
"aria": "/document[1]/link[12]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 484,
"top": 765,
"height": 54,
"width": 86
},
"snippet": "<a data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]",
"aria": "/document[1]/link[11]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 386,
"top": 765,
"height": 54,
"width": 88
},
"snippet": "<a data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]",
"aria": "/document[1]/link[10]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 289,
"top": 765,
"height": 54,
"width": 88
},
"snippet": "<a data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]",
"aria": "/document[1]/link[9]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 195,
"top": 765,
"height": 54,
"width": 85
},
"snippet": "<a data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]",
"aria": "/document[1]/link[8]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 108,
"top": 765,
"height": 54,
"width": 77
},
"snippet": "<a data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[3]/div[1]/div[1]/p[1]",
"aria": "/document[1]/paragraph[8]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 15,
"top": 647,
"height": 58,
"width": 770
},
"snippet": "<p data-generated-css=\"brz-css-erjeq\" data-uniq-id=\"lwuac\" class=\"brz-css-mkkan\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[2]/div[1]/div[1]/p[1]",
"aria": "/document[1]/paragraph[7]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 15,
"top": 560,
"height": 110,
"width": 770
},
"snippet": "<p data-uniq-id=\"hpxfi\" data-generated-css=\"brz-css-kokqw\" class=\"brz-css-lkuyo\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]",
"aria": "/document[1]/paragraph[5]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 102,
"top": 355,
"height": 141,
"width": 598
},
"snippet": "<p data-uniq-id=\"nwtym\" data-generated-css=\"brz-css-armam\" class=\"brz-css-aesxw\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]",
"aria": "/document[1]/paragraph[3]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 102,
"top": 230,
"height": 60,
"width": 598
},
"snippet": "<p data-generated-css=\"brz-css-iqboz\" data-uniq-id=\"acvfi\" class=\"brz-css-mntwc\">",
"level": "violation"
},
{
"ruleId": "aria_content_in_landmark",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]",
"aria": "/document[1]/link[3]"
},
"message": "Content is not within a landmark element",
"bounds": {
"left": 498,
"top": 84,
"height": 54,
"width": 150
},
"snippet": "<a data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\">",
"level": "violation"
},
{
"ruleId": "a_text_purpose",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]",
"aria": "/document[1]/link[2]"
},
"message": "Hyperlink has no link text, label or image with a text alternative",
"bounds": {
"left": 459,
"top": 86,
"height": 48,
"width": 48
},
"snippet": "<a id=\"\" data-brz-link-type=\"popup\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" class=\"brz-a\">",
"level": "violation"
},
{
"ruleId": "a_text_purpose",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"aria": "/document[1]/link[1]"
},
"message": "Hyperlink has no link text, label or image with a text alternative",
"bounds": {
"left": 42,
"top": 56,
"height": 109,
"width": 284
},
"snippet": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\">",
"level": "violation"
},
{
"ruleId": "a_text_purpose",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
"aria": "/document[1]/contentinfo[1]/link[2]"
},
"message": "Hyperlink has no link text, label or image with a text alternative",
"bounds": {
"left": 414,
"top": 2629,
"height": 19,
"width": 32
},
"snippet": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\">",
"level": "violation"
},
{
"ruleId": "a_text_purpose",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"aria": "/document[1]/contentinfo[1]/link[1]"
},
"message": "Hyperlink has no link text, label or image with a text alternative",
"bounds": {
"left": 354,
"top": 2629,
"height": 19,
"width": 32
},
"snippet": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\">",
"level": "violation"
},
{
"ruleId": "element_attribute_deprecated",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]/svg[1]",
"aria": "/document[1]/link[3]/graphics-document[1]"
},
"message": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
"bounds": {
"left": 603,
"top": 102,
"height": 16,
"width": 16
},
"snippet": "<svg data-name=\"tail-right\" data-type=\"glyph\" class=\"brz-icon-svg brz-css-oheuj\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">",
"level": "recommendation"
},
{
"ruleId": "element_attribute_deprecated",
"path": {
"dom": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]/span[1]/svg[1]",
"aria": "/document[1]/link[2]/graphics-document[1]"
},
"message": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
"bounds": {
"left": 459,
"top": 86,
"height": 48,
"width": 48
},
"snippet": "<svg data-name=\"menu-34\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">",
"level": "recommendation"
},
{
"ruleId": "element_attribute_deprecated",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]/span[1]/svg[1]",
"aria": "/document[1]/contentinfo[1]/link[2]/graphics-document[1]"
},
"message": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
"bounds": {
"left": 414,
"top": 2625,
"height": 32,
"width": 32
},
"snippet": "<svg data-name=\"logo-twitter\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">",
"level": "recommendation"
},
{
"ruleId": "element_attribute_deprecated",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]/span[1]/svg[1]",
"aria": "/document[1]/contentinfo[1]/link[1]/graphics-document[1]"
},
"message": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
"bounds": {
"left": 354,
"top": 2625,
"height": 32,
"width": 32
},
"snippet": "<svg data-name=\"logo-facebook\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">",
"level": "recommendation"
},
{
"ruleId": "aria_contentinfo_misuse",
"path": {
"dom": "/html[1]/body[1]/div[1]/footer[1]",
"aria": "/document[1]/contentinfo[1]"
},
"message": "The element with \"contentinfo\" role is present without an element with \"main\" role",
"bounds": {
"left": 0,
"top": 2452,
"height": 464,
"width": 800
},
"snippet": "<footer data-custom-id=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\" class=\"brz-footer brz-css-amejp brz-css-sstgn\" id=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\" data-uid=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\">",
"level": "recommendation"
}
],
"success": true
},
"standardResult": {
"totals": [
0,
5,
0,
43
],
"instances": [
{
"ruleID": "img_alt_valid",
"what": "The image has neither an alt atttribute nor an ARIA label or title",
"ordinalSeverity": 3,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/img[1]"
},
"excerpt": "<img height=\"1\" width=\"1\" src=\"http://ib.adnxs.com/seg?add=30067132&t=2\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]"
},
"excerpt": "<a data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\" id=\"\" data-brz-link-type=\"external\" href=\"/about/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]"
},
"excerpt": "<a data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]"
},
"excerpt": "<a data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]"
},
"excerpt": "<a data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]"
},
"excerpt": "<a data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]"
},
"excerpt": "<a data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\">"
},
{
"ruleID": "element_id_unique",
"what": "The <div> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[3]/div[1]/div[1]/div[1]/div[1]/div[1]"
},
"excerpt": "<div data-custom-id=\"muserakcqcfkwarzkttrfzizvtktwtqbysti\" class=\"brz-icon__container\" id=\"\">"
},
{
"ruleID": "element_id_unique",
"what": "The <div> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]"
},
"excerpt": "<div data-custom-id=\"axlyrxgtqqbwisbspsmpehfdbsksrzxgfgii\" class=\"brz-icon__container\" id=\"\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"popup\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" class=\"brz-a\">"
},
{
"ruleID": "element_id_unique",
"what": "The <div> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]"
},
"excerpt": "<div data-custom-id=\"pceqxnmehonwogvnkufwatiazpvvrypiilwr\" class=\"brz-icon__container\" id=\"\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\">"
},
{
"ruleID": "element_id_unique",
"what": "The <div> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]"
},
"excerpt": "<div data-custom-id=\"nzkalizvyqxpxwhmghgfojzckegcabnhnsiw\" class=\"brz-icon__container\" id=\"\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\">"
},
{
"ruleID": "element_id_unique",
"what": "The <div> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]"
},
"excerpt": "<div data-custom-id=\"gucekfcwzkwvwbcfqjgrflyvigkonlxuvqdd\" class=\"brz-icon__container\" id=\"\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[5]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/issues/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/ad5/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[3]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/news/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/about/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\">"
},
{
"ruleID": "element_id_unique",
"what": "The <a> element has the id \"\" that is empty",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[1]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[7]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
},
"excerpt": "<p data-generated-css=\"brz-css-owucl\" data-uniq-id=\"qxpfh\" class=\"brz-css-bklfk\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]"
},
"excerpt": "<a data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\" id=\"\" data-brz-link-type=\"external\" href=\"/about/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[3]/div[1]/div[1]/p[1]"
},
"excerpt": "<p data-generated-css=\"brz-css-eyoug\" data-uniq-id=\"mdupv\" class=\"brz-css-bnogt\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
},
"excerpt": "<p data-uniq-id=\"ssqmz\" data-generated-css=\"brz-css-fyurj\" class=\"brz-css-nhelt\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[5]/div[1]/div[2]/div[1]/div[1]/div[2]/div[2]/div[1]/div[1]/div[1]/p[1]"
},
"excerpt": "<p class=\"brz-css-dbkfe\" data-generated-css=\"brz-css-owosm\" data-uniq-id=\"hwwdz\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]"
},
"excerpt": "<a data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]"
},
"excerpt": "<a data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]"
},
"excerpt": "<a data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]"
},
"excerpt": "<a data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]"
},
"excerpt": "<a data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[3]/div[1]/div[1]/p[1]"
},
"excerpt": "<p data-generated-css=\"brz-css-erjeq\" data-uniq-id=\"lwuac\" class=\"brz-css-mkkan\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[2]/div[1]/div[1]/p[1]"
},
"excerpt": "<p data-uniq-id=\"hpxfi\" data-generated-css=\"brz-css-kokqw\" class=\"brz-css-lkuyo\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]"
},
"excerpt": "<p data-uniq-id=\"nwtym\" data-generated-css=\"brz-css-armam\" class=\"brz-css-aesxw\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[1]"
},
"excerpt": "<p data-generated-css=\"brz-css-iqboz\" data-uniq-id=\"acvfi\" class=\"brz-css-mntwc\">"
},
{
"ruleID": "aria_content_in_landmark",
"what": "Content is not within a landmark element",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\" id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\">"
},
{
"ruleID": "a_text_purpose",
"what": "Hyperlink has no link text, label or image with a text alternative",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"popup\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" class=\"brz-a\">"
},
{
"ruleID": "a_text_purpose",
"what": "Hyperlink has no link text, label or image with a text alternative",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\" id=\"\" data-brz-link-type=\"external\" href=\"https://joepatterson.com/\" class=\"brz-a\">"
},
{
"ruleID": "a_text_purpose",
"what": "Hyperlink has no link text, label or image with a text alternative",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://twitter.com/Patterdude\" class=\"brz-a\">"
},
{
"ruleID": "a_text_purpose",
"what": "Hyperlink has no link text, label or image with a text alternative",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a id=\"\" data-brz-link-type=\"external\" rel=\"noopener\" target=\"_blank\" href=\"https://www.facebook.com/PattersonForAssembly\" class=\"brz-a\">"
},
{
"ruleID": "element_attribute_deprecated",
"what": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
"ordinalSeverity": 1,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]/svg[1]"
},
"excerpt": "<svg data-name=\"tail-right\" data-type=\"glyph\" class=\"brz-icon-svg brz-css-oheuj\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">"
},
{
"ruleID": "element_attribute_deprecated",
"what": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
"ordinalSeverity": 1,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]/span[1]/svg[1]"
},
"excerpt": "<svg data-name=\"menu-34\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">"
},
{
"ruleID": "element_attribute_deprecated",
"what": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
"ordinalSeverity": 1,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]/span[1]/svg[1]"
},
"excerpt": "<svg data-name=\"logo-twitter\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">"
},
{
"ruleID": "element_attribute_deprecated",
"what": "The HTML attribute(s) \"version\" is deprecated in HTML 5",
"ordinalSeverity": 1,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]/span[1]/svg[1]"
},
"excerpt": "<svg data-name=\"logo-facebook\" data-type=\"glyph\" class=\"brz-icon-svg\" xml:space=\"preserve\" viewBox=\"0 0 24 24\" y=\"0px\" x=\"0px\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" xmlns=\"http://www.w3.org/2000/svg\" version=\"1.1\">"
},
{
"ruleID": "aria_contentinfo_misuse",
"what": "The element with \"contentinfo\" role is present without an element with \"main\" role",
"ordinalSeverity": 1,
"tagName": "FOOTER",
"id": "ekgwjnuvotyydehtoshkvsgqrplvompyerpl",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html[1]/body[1]/div[1]/footer[1]"
},
"excerpt": "<footer data-custom-id=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\" class=\"brz-footer brz-css-amejp brz-css-sstgn\" id=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\" data-uid=\"ekgwjnuvotyydehtoshkvsgqrplvompyerpl\">"
}
]
},
"endTime": 1687099522771
},
{
"type": "launch",
"which": "chromium",
"startTime": 1687099522771,
"endTime": 1687099523406
},
{
"type": "url",
"which": "https://joepatterson.com/",
"what": "Candidate Joe Patterson (R)",
"startTime": 1687099523407,
"result": {
"url": "https://joepatterson.com/"
},
"endTime": 1687099524794
},
{
"type": "test",
"which": "nuVal",
"startTime": 1687099524794,
"url": "https://joepatterson.com/",
"what": "Nu Html Checker",
"result": {
"pageContent": {
"messages": [
{
"type": "error",
"lastLine": 110,
"firstLine": 108,
"lastColumn": 2,
"firstColumn": 11,
"message": "Bad start tag in img in noscript in head.",
"extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
"hiliteStart": 10,
"hiliteLength": 126
},
{
"type": "error",
"lastLine": 110,
"firstLine": 108,
"lastColumn": 2,
"firstColumn": 11,
"message": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
"extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
"hiliteStart": 10,
"hiliteLength": 126
},
{
"type": "info",
"lastLine": 110,
"firstLine": 108,
"lastColumn": 2,
"firstColumn": 11,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
"hiliteStart": 10,
"hiliteLength": 126
},
{
"type": "error",
"lastLine": 110,
"lastColumn": 13,
"firstColumn": 3,
"message": "Stray end tag noscript.",
"extract": "ript=1\"\n/></noscript>\n<!-- ",
"hiliteStart": 10,
"hiliteLength": 11
},
{
"type": "info",
"lastLine": 113,
"lastColumn": 167,
"firstColumn": 81,
"subType": "warning",
"message": "The type attribute is unnecessary for JavaScript resources.",
"extract": "MODIFY --><script src=\"https://secure.adnxs.com/seg?add=30067132&t=1\" type=\"text/javascript\"></scri",
"hiliteStart": 10,
"hiliteLength": 87
},
{
"type": "error",
"lastLine": 115,
"lastColumn": 145,
"firstColumn": 139,
"message": "Stray end tag head.",
"extract": "></script></head><body ",
"hiliteStart": 10,
"hiliteLength": 7
},
{
"type": "error",
"lastLine": 115,
"lastColumn": 461,
"firstColumn": 146,
"message": "Start tag body seen but an element of the same type was already open.",
"extract": "pt></head><body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz brz-mm-wrapper\" style=\"\"><img s",
"hiliteStart": 10,
"hiliteLength": 316
},
{
"type": "error",
"lastLine": 115,
"lastColumn": 461,
"firstColumn": 146,
"subType": "fatal",
"message": "Cannot recover after last error. Any further errors will be ignored.",
"extract": "pt></head><body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz brz-mm-wrapper\" style=\"\"><img s",
"hiliteStart": 10,
"hiliteLength": 316
}
]
},
"rawPage": {
"messages": [
{
"type": "info",
"lastLine": 11,
"lastColumn": 66,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "2.0 -->\n\t\t<meta name=\"description\" content=\"Joe Patterson for Assembly\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 64
},
{
"type": "info",
"lastLine": 12,
"lastColumn": 58,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "bly\" />\n\t\t<meta name=\"robots\" content=\"max-image-preview:large\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 56
},
{
"type": "info",
"lastLine": 13,
"lastColumn": 121,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "rge\" />\n\t\t<meta name=\"google-site-verification\" content=\"google-site-verification=gQYW2QR6cad9zs_bhpn9WTkMktiJqpHCGlGIqG5akk4\" />\n\t\t<li",
"hiliteStart": 10,
"hiliteLength": 119
},
{
"type": "info",
"lastLine": 14,
"lastColumn": 59,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "kk4\" />\n\t\t<link rel=\"canonical\" href=\"https://joepatterson.com/\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 57
},
{
"type": "info",
"lastLine": 15,
"lastColumn": 47,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "om/\" />\n\t\t<meta property=\"og:locale\" content=\"en_US\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 45
},
{
"type": "info",
"lastLine": 16,
"lastColumn": 60,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "_US\" />\n\t\t<meta property=\"og:site_name\" content=\"Joe Patterson -\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 58
},
{
"type": "info",
"lastLine": 17,
"lastColumn": 47,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "n -\" />\n\t\t<meta property=\"og:type\" content=\"website\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 45
},
{
"type": "info",
"lastLine": 18,
"lastColumn": 54,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "ite\" />\n\t\t<meta property=\"og:title\" content=\"Joe Patterson\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 52
},
{
"type": "info",
"lastLine": 19,
"lastColumn": 73,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "son\" />\n\t\t<meta property=\"og:description\" content=\"Joe Patterson for Assembly\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 71
},
{
"type": "info",
"lastLine": 20,
"lastColumn": 64,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "bly\" />\n\t\t<meta property=\"og:url\" content=\"https://joepatterson.com/\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 62
},
{
"type": "info",
"lastLine": 21,
"lastColumn": 161,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "om/\" />\n\t\t<meta property=\"og:image\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 159
},
{
"type": "info",
"lastLine": 22,
"lastColumn": 172,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "jpg\" />\n\t\t<meta property=\"og:image:secure_url\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 170
},
{
"type": "info",
"lastLine": 23,
"lastColumn": 51,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "jpg\" />\n\t\t<meta property=\"og:image:width\" content=\"2048\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 49
},
{
"type": "info",
"lastLine": 24,
"lastColumn": 52,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "048\" />\n\t\t<meta property=\"og:image:height\" content=\"1365\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 50
},
{
"type": "info",
"lastLine": 25,
"lastColumn": 48,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "365\" />\n\t\t<meta name=\"twitter:card\" content=\"summary\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 46
},
{
"type": "info",
"lastLine": 26,
"lastColumn": 52,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "ary\" />\n\t\t<meta name=\"twitter:site\" content=\"@Patterdude\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 50
},
{
"type": "info",
"lastLine": 27,
"lastColumn": 55,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "ude\" />\n\t\t<meta name=\"twitter:title\" content=\"Joe Patterson\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 53
},
{
"type": "info",
"lastLine": 28,
"lastColumn": 74,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "son\" />\n\t\t<meta name=\"twitter:description\" content=\"Joe Patterson for Assembly\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 72
},
{
"type": "info",
"lastLine": 29,
"lastColumn": 55,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "bly\" />\n\t\t<meta name=\"twitter:creator\" content=\"@Patterdude\" />\n\t\t<me",
"hiliteStart": 10,
"hiliteLength": 53
},
{
"type": "info",
"lastLine": 30,
"lastColumn": 162,
"firstColumn": 3,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "ude\" />\n\t\t<meta name=\"twitter:image\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" />\n\t\t<sc",
"hiliteStart": 10,
"hiliteLength": 160
},
{
"type": "info",
"lastLine": 36,
"lastColumn": 57,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": " SEO -->\n\n<link rel='dns-prefetch' href='//fonts.googleapis.com' />\n<link",
"hiliteStart": 10,
"hiliteLength": 57
},
{
"type": "info",
"lastLine": 37,
"lastColumn": 124,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "s.com' />\n<link rel=\"alternate\" type=\"application/rss+xml\" title=\"Joe Patterson » Feed\" href=\"https://joepatterson.com/feed/\" />\n<link",
"hiliteStart": 10,
"hiliteLength": 124
},
{
"type": "info",
"lastLine": 38,
"lastColumn": 142,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "feed/\" />\n<link rel=\"alternate\" type=\"application/rss+xml\" title=\"Joe Patterson » Comments Feed\" href=\"https://joepatterson.com/comments/feed/\" />\n\t\t<!-",
"hiliteStart": 10,
"hiliteLength": 142
},
{
"type": "info",
"lastLine": 62,
"lastColumn": 163,
"firstColumn": 2,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "</style>\n\t<link rel='stylesheet' id='astra-theme-css-css' href='https://joepatterson.com/wp-content/themes/astra/assets/css/minified/main.min.css?ver=3.7.10' media='all' />\n<styl",
"hiliteStart": 10,
"hiliteLength": 162
},
{
"type": "info",
"lastLine": 66,
"lastColumn": 154,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "\n</style>\n<link rel='stylesheet' id='wp-block-library-css' href='https://joepatterson.com/wp-includes/css/dist/block-library/style.min.css?ver=6.2.2' media='all' />\n<styl",
"hiliteStart": 10,
"hiliteLength": 154
},
{
"type": "info",
"lastLine": 73,
"lastColumn": 871,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "\n</style>\n<link rel='stylesheet' id='brizy-asset-google-10-css' class=\"brz-link brz-link-google\" type=\"text/css\" href='https://fonts.googleapis.com/css?family=Overpass%3A100%2C100italic%2C200%2C200italic%2C300%2C300italic%2Cregular%2Citalic%2C600%2C600italic%2C700%2C700italic%2C800%2C800italic%2C900%2C900italic%7CMontserrat%3A100%2C100italic%2C200%2C200italic%2C300%2C300italic%2Cregular%2Citalic%2C500%2C500italic%2C600%2C600italic%2C700%2C700italic%2C800%2C800italic%2C900%2C900italic%7CLato%3A100%2C100italic%2C300%2C300italic%2Cregular%2Citalic%2C700%2C700italic%2C900%2C900italic%7CRed+Hat+Text%3Aregular%2Citalic%2C500%2C500italic%2C700%2C700italic&subset=arabic%2Cbengali%2Ccyrillic%2Ccyrillic-ext%2Cdevanagari%2Cgreek%2Cgreek-ext%2Cgujarati%2Chebrew%2Ckhmer%2Ckorean%2Clatin-ext%2Ctamil%2Ctelugu%2Cthai%2Cvietnamese&display=swap&ver=2.3.35' media='all' />\n<link",
"hiliteStart": 10,
"hiliteLength": 871
},
{
"type": "info",
"lastLine": 74,
"lastColumn": 247,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "='all' />\n<link rel='stylesheet' id='brizy-asset-group-1-20-css' class=\"brz-link brz-link-preview-lib\" data-group=\"group-1\" href='https://joepatterson.com/wp-content/plugins/brizy/public/editor-build/232-wp/editor/css/group-1.css?ver=2.3.35' media='all' />\n<link",
"hiliteStart": 10,
"hiliteLength": 247
},
{
"type": "info",
"lastLine": 75,
"lastColumn": 252,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "='all' />\n<link rel='stylesheet' id='brizy-asset-group-2-21-css' class=\"brz-link brz-link-preview-lib-pro\" data-group=\"group-2\" href='https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/group-2-pro.css?ver=2.3.28' media='all' />\n<link",
"hiliteStart": 10,
"hiliteLength": 252
},
{
"type": "info",
"lastLine": 76,
"lastColumn": 224,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "='all' />\n<link rel='stylesheet' id='brizy-asset-main-30-css' class=\"brz-link brz-link-preview-pro\" href='https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/preview.pro.css?ver=2.3.28' media='all' />\n<styl",
"hiliteStart": 10,
"hiliteLength": 224
},
{
"type": "info",
"lastLine": 91,
"lastColumn": 74,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "</script>\n<link rel=\"https://api.w.org/\" href=\"https://joepatterson.com/wp-json/\" /><link ",
"hiliteStart": 10,
"hiliteLength": 74
},
{
"type": "info",
"lastLine": 91,
"lastColumn": 177,
"firstColumn": 75,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "-json/\" /><link rel=\"alternate\" type=\"application/json\" href=\"https://joepatterson.com/wp-json/wp/v2/pages/16\" /><link ",
"hiliteStart": 10,
"hiliteLength": 103
},
{
"type": "info",
"lastLine": 91,
"lastColumn": 285,
"firstColumn": 178,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "ges/16\" /><link rel=\"EditURI\" type=\"application/rsd+xml\" title=\"RSD\" href=\"https://joepatterson.com/xmlrpc.php?rsd\" />\n<link",
"hiliteStart": 10,
"hiliteLength": 108
},
{
"type": "info",
"lastLine": 92,
"lastColumn": 121,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "p?rsd\" />\n<link rel=\"wlwmanifest\" type=\"application/wlwmanifest+xml\" href=\"https://joepatterson.com/wp-includes/wlwmanifest.xml\" />\n<meta",
"hiliteStart": 10,
"hiliteLength": 121
},
{
"type": "info",
"lastLine": 93,
"lastColumn": 51,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "t.xml\" />\n<meta name=\"generator\" content=\"WordPress 6.2.2\" />\n<link",
"hiliteStart": 10,
"hiliteLength": 51
},
{
"type": "info",
"lastLine": 94,
"lastColumn": 57,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "6.2.2\" />\n<link rel='shortlink' href='https://joepatterson.com/' />\n<link",
"hiliteStart": 10,
"hiliteLength": 57
},
{
"type": "info",
"lastLine": 95,
"lastColumn": 150,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": ".com/' />\n<link rel=\"alternate\" type=\"application/json+oembed\" href=\"https://joepatterson.com/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fjoepatterson.com%2F\" />\n<link",
"hiliteStart": 10,
"hiliteLength": 150
},
{
"type": "info",
"lastLine": 96,
"lastColumn": 158,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "om%2F\" />\n<link rel=\"alternate\" type=\"text/xml+oembed\" href=\"https://joepatterson.com/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fjoepatterson.com%2F&format=xml\" />\n<meta",
"hiliteStart": 10,
"hiliteLength": 158
},
{
"type": "info",
"lastLine": 97,
"lastColumn": 85,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "t=xml\" />\n<meta name=\"facebook-domain-verification\" content=\"1tt0ezdlks2lf51jfn2nqzm3lnirj0\" />\n<!-- ",
"hiliteStart": 10,
"hiliteLength": 85
},
{
"type": "error",
"lastLine": 113,
"firstLine": 111,
"lastColumn": 2,
"firstColumn": 11,
"message": "Bad start tag in img in noscript in head.",
"extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
"hiliteStart": 10,
"hiliteLength": 126
},
{
"type": "error",
"lastLine": 113,
"firstLine": 111,
"lastColumn": 2,
"firstColumn": 11,
"message": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
"extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
"hiliteStart": 10,
"hiliteLength": 126
},
{
"type": "info",
"lastLine": 113,
"firstLine": 111,
"lastColumn": 2,
"firstColumn": 11,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\"\n/></nosc",
"hiliteStart": 10,
"hiliteLength": 126
},
{
"type": "error",
"lastLine": 113,
"lastColumn": 13,
"firstColumn": 3,
"message": "Stray end tag noscript.",
"extract": "ript=1\"\n/></noscript>\n<!-- ",
"hiliteStart": 10,
"hiliteLength": 11
},
{
"type": "info",
"lastLine": 116,
"lastColumn": 163,
"firstColumn": 81,
"subType": "warning",
"message": "The type attribute is unnecessary for JavaScript resources.",
"extract": "MODIFY --><script src='https://secure.adnxs.com/seg?add=30067132&t=1' type='text/javascript'></scri",
"hiliteStart": 10,
"hiliteLength": 83
},
{
"type": "error",
"lastLine": 118,
"lastColumn": 155,
"firstColumn": 81,
"message": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
"extract": "MODIFY --><img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\" /><!-- E",
"hiliteStart": 10,
"hiliteLength": 75
},
{
"type": "info",
"lastLine": 118,
"lastColumn": 155,
"firstColumn": 81,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "MODIFY --><img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\" /><!-- E",
"hiliteStart": 10,
"hiliteLength": 75
},
{
"type": "info",
"lastLine": 120,
"lastColumn": 31,
"firstColumn": 1,
"subType": "warning",
"message": "The type attribute is unnecessary for JavaScript resources.",
"extract": " Code -->\n<script type='text/javascript'>\n!func",
"hiliteStart": 10,
"hiliteLength": 31
},
{
"type": "info",
"lastLine": 128,
"lastColumn": 31,
"firstColumn": 1,
"subType": "warning",
"message": "The type attribute is unnecessary for JavaScript resources.",
"extract": " Code -->\n<script type='text/javascript'>\n fbq",
"hiliteStart": 10,
"hiliteLength": 31
},
{
"type": "info",
"lastLine": 132,
"lastColumn": 40,
"firstColumn": 10,
"subType": "warning",
"message": "The type attribute is unnecessary for JavaScript resources.",
"extract": "\n</script><script type='text/javascript'>\n fbq",
"hiliteStart": 10,
"hiliteLength": 31
},
{
"type": "info",
"lastLine": 138,
"firstLine": 137,
"lastColumn": 79,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "noscript>\n<img height=\"1\" width=\"1\" style=\"display:none\" alt=\"fbpx\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" />\n</nos",
"hiliteStart": 10,
"hiliteLength": 137
},
{
"type": "error",
"lastLine": 141,
"lastColumn": 68,
"firstColumn": 1,
"message": "Attribute name not allowed on element meta at this point.",
"extract": " Code -->\n<meta name=\"viewport\" content=\"width=device-width, initial-scale=1\">\n<link",
"hiliteStart": 10,
"hiliteLength": 68
},
{
"type": "error",
"lastLine": 141,
"lastColumn": 68,
"firstColumn": 1,
"message": "Element meta is missing one or more of the following attributes: itemprop, property.",
"extract": " Code -->\n<meta name=\"viewport\" content=\"width=device-width, initial-scale=1\">\n<link",
"hiliteStart": 10,
"hiliteLength": 68
},
{
"type": "error",
"lastLine": 143,
"lastColumn": 25,
"firstColumn": 1,
"message": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
"extract": "ssorigin>\n<style class=\"brz-style\">.brz .",
"hiliteStart": 10,
"hiliteLength": 25
},
{
"type": "error",
"lastLine": 143,
"lastColumn": 5938,
"firstColumn": 5914,
"message": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
"extract": "}}</style><style class=\"brz-style\">@media",
"hiliteStart": 10,
"hiliteLength": 25
},
{
"type": "error",
"lastLine": 154,
"lastColumn": 4938,
"message": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"extract": "x + 10px + 10px); padding-righ",
"hiliteStart": 15,
"hiliteLength": 1
},
{
"type": "error",
"lastLine": 154,
"lastColumn": 10896,
"message": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"extract": "x + 10px + 10px); padding-righ",
"hiliteStart": 15,
"hiliteLength": 1
},
{
"type": "error",
"lastLine": 154,
"lastColumn": 17278,
"message": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"extract": "x + 10px + 10px); padding-righ",
"hiliteStart": 15,
"hiliteLength": 1
},
{
"type": "error",
"lastLine": 204,
"lastColumn": 4078,
"message": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"extract": "x + 10px + 10px); padding-righ",
"hiliteStart": 15,
"hiliteLength": 1
},
{
"type": "error",
"lastLine": 349,
"lastColumn": 124,
"firstColumn": 1,
"message": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
"extract": "\n</style>\n<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\" />\n<link",
"hiliteStart": 10,
"hiliteLength": 124
},
{
"type": "info",
"lastLine": 349,
"lastColumn": 124,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "\n</style>\n<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\" />\n<link",
"hiliteStart": 10,
"hiliteLength": 124
},
{
"type": "error",
"lastLine": 350,
"lastColumn": 128,
"firstColumn": 1,
"message": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
"extract": "32x32\" />\n<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\" />\n<link",
"hiliteStart": 10,
"hiliteLength": 128
},
{
"type": "info",
"lastLine": 350,
"lastColumn": 128,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "32x32\" />\n<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\" />\n<link",
"hiliteStart": 10,
"hiliteLength": 128
},
{
"type": "error",
"lastLine": 351,
"lastColumn": 124,
"firstColumn": 1,
"message": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
"extract": "2x192\" />\n<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\" />\n<meta",
"hiliteStart": 10,
"hiliteLength": 124
},
{
"type": "info",
"lastLine": 351,
"lastColumn": 124,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "2x192\" />\n<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\" />\n<meta",
"hiliteStart": 10,
"hiliteLength": 124
},
{
"type": "error",
"lastLine": 352,
"lastColumn": 135,
"firstColumn": 1,
"message": "Attribute name not allowed on element meta at this point.",
"extract": "0.jpg\" />\n<meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" />\n</hea",
"hiliteStart": 10,
"hiliteLength": 135
},
{
"type": "error",
"lastLine": 352,
"lastColumn": 135,
"firstColumn": 1,
"message": "Element meta is missing one or more of the following attributes: itemprop, property.",
"extract": "0.jpg\" />\n<meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" />\n</hea",
"hiliteStart": 10,
"hiliteLength": 135
},
{
"type": "info",
"lastLine": 352,
"lastColumn": 135,
"firstColumn": 1,
"message": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"extract": "0.jpg\" />\n<meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" />\n</hea",
"hiliteStart": 10,
"hiliteLength": 135
},
{
"type": "error",
"lastLine": 353,
"lastColumn": 7,
"firstColumn": 1,
"message": "Stray end tag head.",
"extract": "0.jpg\" />\n</head>\n<body",
"hiliteStart": 10,
"hiliteLength": 7
},
{
"type": "error",
"lastLine": 354,
"lastColumn": 292,
"firstColumn": 1,
"message": "Start tag body seen but an element of the same type was already open.",
"extract": ">\n</head>\n<body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz\">\n <",
"hiliteStart": 10,
"hiliteLength": 292
},
{
"type": "error",
"lastLine": 354,
"lastColumn": 292,
"firstColumn": 1,
"subType": "fatal",
"message": "Cannot recover after last error. Any further errors will be ignored.",
"extract": ">\n</head>\n<body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz\">\n <",
"hiliteStart": 10,
"hiliteLength": 292
}
]
},
"success": true
},
"standardResult": {
"totals": [
5,
0,
24,
2
],
"instances": [
{
"ruleID": "Bad start tag in img in noscript in head.",
"what": "Bad start tag in img in noscript in head.",
"ordinalSeverity": 2,
"tagName": "NOSCRIPT",
"id": "",
"location": {
"doc": "dom",
"type": "line",
"spec": "110"
},
"excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
},
{
"ruleID": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
"what": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
"ordinalSeverity": 2,
"tagName": "NOSCRIPT",
"id": "",
"location": {
"doc": "dom",
"type": "line",
"spec": "110"
},
"excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "NOSCRIPT",
"id": "",
"location": {
"doc": "dom",
"type": "line",
"spec": "110"
},
"excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
},
{
"ruleID": "Stray end tag noscript.",
"what": "Stray end tag noscript.",
"ordinalSeverity": 2,
"tagName": "",
"id": "",
"location": {
"doc": "dom",
"type": "line",
"spec": "110"
},
"excerpt": "ript=1\" /></noscript> <!-- "
},
{
"ruleID": "The type attribute is unnecessary for JavaScript resources.",
"what": "The type attribute is unnecessary for JavaScript resources.",
"ordinalSeverity": 0,
"tagName": "SCRIPT",
"id": "",
"location": {
"doc": "dom",
"type": "line",
"spec": "113"
},
"excerpt": "MODIFY --><script src=\"https://secure.adnxs.com/seg?add=30067132&t=1\" type=\"text/javascript\"></scri"
},
{
"ruleID": "Stray end tag head.",
"what": "Stray end tag head.",
"ordinalSeverity": 2,
"tagName": "BODY",
"id": "",
"location": {
"doc": "dom",
"type": "line",
"spec": "115"
},
"excerpt": "></script></head><body "
},
{
"ruleID": "Start tag body seen but an element of the same type was already open.",
"what": "Start tag body seen but an element of the same type was already open.",
"ordinalSeverity": 2,
"tagName": "BODY",
"id": "",
"location": {
"doc": "dom",
"type": "line",
"spec": "115"
},
"excerpt": "pt></head><body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz brz-mm-wrapper\" style=\"\"><img s"
},
{
"ruleID": "Cannot recover after last error. Any further errors will be ignored.",
"what": "Cannot recover after last error. Any further errors will be ignored.",
"ordinalSeverity": 3,
"tagName": "BODY",
"id": "",
"location": {
"doc": "dom",
"type": "line",
"spec": "115"
},
"excerpt": "pt></head><body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz brz-mm-wrapper\" style=\"\"><img s"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "11"
},
"excerpt": "2.0 --> <meta name=\"description\" content=\"Joe Patterson for Assembly\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "12"
},
"excerpt": "bly\" /> <meta name=\"robots\" content=\"max-image-preview:large\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "13"
},
"excerpt": "rge\" /> <meta name=\"google-site-verification\" content=\"google-site-verification=gQYW2QR6cad9zs_bhpn9WTkMktiJqpHCGlGIqG5akk4\" /> <li"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "14"
},
"excerpt": "kk4\" /> <link rel=\"canonical\" href=\"https://joepatterson.com/\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "15"
},
"excerpt": "om/\" /> <meta property=\"og:locale\" content=\"en_US\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "16"
},
"excerpt": "_US\" /> <meta property=\"og:site_name\" content=\"Joe Patterson -\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "17"
},
"excerpt": "n -\" /> <meta property=\"og:type\" content=\"website\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "18"
},
"excerpt": "ite\" /> <meta property=\"og:title\" content=\"Joe Patterson\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "19"
},
"excerpt": "son\" /> <meta property=\"og:description\" content=\"Joe Patterson for Assembly\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "20"
},
"excerpt": "bly\" /> <meta property=\"og:url\" content=\"https://joepatterson.com/\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "21"
},
"excerpt": "om/\" /> <meta property=\"og:image\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "22"
},
"excerpt": "jpg\" /> <meta property=\"og:image:secure_url\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "23"
},
"excerpt": "jpg\" /> <meta property=\"og:image:width\" content=\"2048\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "24"
},
"excerpt": "048\" /> <meta property=\"og:image:height\" content=\"1365\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "25"
},
"excerpt": "365\" /> <meta name=\"twitter:card\" content=\"summary\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "26"
},
"excerpt": "ary\" /> <meta name=\"twitter:site\" content=\"@Patterdude\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "27"
},
"excerpt": "ude\" /> <meta name=\"twitter:title\" content=\"Joe Patterson\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "28"
},
"excerpt": "son\" /> <meta name=\"twitter:description\" content=\"Joe Patterson for Assembly\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "29"
},
"excerpt": "bly\" /> <meta name=\"twitter:creator\" content=\"@Patterdude\" /> <me"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "30"
},
"excerpt": "ude\" /> <meta name=\"twitter:image\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/14257577_1728728760722907_1945156269771735087_o_1728728760722907.jpg\" /> <sc"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "36"
},
"excerpt": " SEO --> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "37"
},
"excerpt": "s.com' /> <link rel=\"alternate\" type=\"application/rss+xml\" title=\"Joe Patterson » Feed\" href=\"https://joepatterson.com/feed/\" /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "38"
},
"excerpt": "feed/\" /> <link rel=\"alternate\" type=\"application/rss+xml\" title=\"Joe Patterson » Comments Feed\" href=\"https://joepatterson.com/comments/feed/\" /> <!-"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "62"
},
"excerpt": "</style> <link rel='stylesheet' id='astra-theme-css-css' href='https://joepatterson.com/wp-content/themes/astra/assets/css/minified/main.min.css?ver=3.7.10' media='all' /> <styl"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "66"
},
"excerpt": " </style> <link rel='stylesheet' id='wp-block-library-css' href='https://joepatterson.com/wp-includes/css/dist/block-library/style.min.css?ver=6.2.2' media='all' /> <styl"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "73"
},
"excerpt": " </style> <link rel='stylesheet' id='brizy-asset-google-10-css' class=\"brz-link brz-link-google\" type=\"text/css\" href='https://fonts.googleapis.com/css?family=Overpass%3A100%2C100italic%2C200%2C200ita ... 2Ccyrillic%2Ccyrillic-ext%2Cdevanagari%2Cgreek%2Cgreek-ext%2Cgujarati%2Chebrew%2Ckhmer%2Ckorean%2Clatin-ext%2Ctamil%2Ctelugu%2Cthai%2Cvietnamese&display=swap&ver=2.3.35' media='all' /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "74"
},
"excerpt": "='all' /> <link rel='stylesheet' id='brizy-asset-group-1-20-css' class=\"brz-link brz-link-preview-lib\" data-group=\"group-1\" href='https://joepatterson.com/wp-content/plugins/brizy/public/editor-build/232-wp/editor/css/group-1.css?ver=2.3.35' media='all' /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "75"
},
"excerpt": "='all' /> <link rel='stylesheet' id='brizy-asset-group-2-21-css' class=\"brz-link brz-link-preview-lib-pro\" data-group=\"group-2\" href='https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/group-2-pro.css?ver=2.3.28' media='all' /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "76"
},
"excerpt": "='all' /> <link rel='stylesheet' id='brizy-asset-main-30-css' class=\"brz-link brz-link-preview-pro\" href='https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/preview.pro.css?ver=2.3.28' media='all' /> <styl"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "91"
},
"excerpt": "</script> <link rel=\"https://api.w.org/\" href=\"https://joepatterson.com/wp-json/\" /><link "
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "91"
},
"excerpt": "-json/\" /><link rel=\"alternate\" type=\"application/json\" href=\"https://joepatterson.com/wp-json/wp/v2/pages/16\" /><link "
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "91"
},
"excerpt": "ges/16\" /><link rel=\"EditURI\" type=\"application/rsd+xml\" title=\"RSD\" href=\"https://joepatterson.com/xmlrpc.php?rsd\" /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "92"
},
"excerpt": "p?rsd\" /> <link rel=\"wlwmanifest\" type=\"application/wlwmanifest+xml\" href=\"https://joepatterson.com/wp-includes/wlwmanifest.xml\" /> <meta"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "93"
},
"excerpt": "t.xml\" /> <meta name=\"generator\" content=\"WordPress 6.2.2\" /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "94"
},
"excerpt": "6.2.2\" /> <link rel='shortlink' href='https://joepatterson.com/' /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "95"
},
"excerpt": ".com/' /> <link rel=\"alternate\" type=\"application/json+oembed\" href=\"https://joepatterson.com/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fjoepatterson.com%2F\" /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "96"
},
"excerpt": "om%2F\" /> <link rel=\"alternate\" type=\"text/xml+oembed\" href=\"https://joepatterson.com/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fjoepatterson.com%2F&format=xml\" /> <meta"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "97"
},
"excerpt": "t=xml\" /> <meta name=\"facebook-domain-verification\" content=\"1tt0ezdlks2lf51jfn2nqzm3lnirj0\" /> <!-- "
},
{
"ruleID": "Bad start tag in img in noscript in head.",
"what": "Bad start tag in img in noscript in head.",
"ordinalSeverity": 2,
"tagName": "NOSCRIPT",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "113"
},
"excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
},
{
"ruleID": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
"what": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
"ordinalSeverity": 2,
"tagName": "NOSCRIPT",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "113"
},
"excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "NOSCRIPT",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "113"
},
"excerpt": "<noscript><img height=\"1\" width=\"1\" style=\"display:none\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /></nosc"
},
{
"ruleID": "Stray end tag noscript.",
"what": "Stray end tag noscript.",
"ordinalSeverity": 2,
"tagName": "",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "113"
},
"excerpt": "ript=1\" /></noscript> <!-- "
},
{
"ruleID": "The type attribute is unnecessary for JavaScript resources.",
"what": "The type attribute is unnecessary for JavaScript resources.",
"ordinalSeverity": 0,
"tagName": "SCRIPT",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "116"
},
"excerpt": "MODIFY --><script src='https://secure.adnxs.com/seg?add=30067132&t=1' type='text/javascript'></scri"
},
{
"ruleID": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
"what": "An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.",
"ordinalSeverity": 2,
"tagName": "IMG",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "118"
},
"excerpt": "MODIFY --><img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\" /><!-- E"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "IMG",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "118"
},
"excerpt": "MODIFY --><img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\" /><!-- E"
},
{
"ruleID": "The type attribute is unnecessary for JavaScript resources.",
"what": "The type attribute is unnecessary for JavaScript resources.",
"ordinalSeverity": 0,
"tagName": "SCRIPT",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "120"
},
"excerpt": " Code --> <script type='text/javascript'> !func"
},
{
"ruleID": "The type attribute is unnecessary for JavaScript resources.",
"what": "The type attribute is unnecessary for JavaScript resources.",
"ordinalSeverity": 0,
"tagName": "SCRIPT",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "128"
},
"excerpt": " Code --> <script type='text/javascript'> fbq"
},
{
"ruleID": "The type attribute is unnecessary for JavaScript resources.",
"what": "The type attribute is unnecessary for JavaScript resources.",
"ordinalSeverity": 0,
"tagName": "SCRIPT",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "132"
},
"excerpt": " </script><script type='text/javascript'> fbq"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "IMG",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "138"
},
"excerpt": "noscript> <img height=\"1\" width=\"1\" style=\"display:none\" alt=\"fbpx\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /> </nos"
},
{
"ruleID": "Attribute name not allowed on element meta at this point.",
"what": "Attribute name not allowed on element meta at this point.",
"ordinalSeverity": 2,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "141"
},
"excerpt": " Code --> <meta name=\"viewport\" content=\"width=device-width, initial-scale=1\"> <link"
},
{
"ruleID": "Element meta is missing one or more of the following attributes: itemprop, property.",
"what": "Element meta is missing one or more of the following attributes: itemprop, property.",
"ordinalSeverity": 2,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "141"
},
"excerpt": " Code --> <meta name=\"viewport\" content=\"width=device-width, initial-scale=1\"> <link"
},
{
"ruleID": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
"what": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
"ordinalSeverity": 2,
"tagName": "STYLE",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "143"
},
"excerpt": "ssorigin> <style class=\"brz-style\">.brz ."
},
{
"ruleID": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
"what": "Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)",
"ordinalSeverity": 2,
"tagName": "STYLE",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "143"
},
"excerpt": "}}</style><style class=\"brz-style\">@media"
},
{
"ruleID": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"what": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"ordinalSeverity": 2,
"tagName": "",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "154"
},
"excerpt": "x + 10px + 10px); padding-righ"
},
{
"ruleID": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"what": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"ordinalSeverity": 2,
"tagName": "",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "154"
},
"excerpt": "x + 10px + 10px); padding-righ"
},
{
"ruleID": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"what": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"ordinalSeverity": 2,
"tagName": "",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "154"
},
"excerpt": "x + 10px + 10px); padding-righ"
},
{
"ruleID": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"what": "CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark.",
"ordinalSeverity": 2,
"tagName": "",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "204"
},
"excerpt": "x + 10px + 10px); padding-righ"
},
{
"ruleID": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
"what": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
"ordinalSeverity": 2,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "349"
},
"excerpt": " </style> <link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\" /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "349"
},
"excerpt": " </style> <link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\" /> <link"
},
{
"ruleID": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
"what": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
"ordinalSeverity": 2,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "350"
},
"excerpt": "32x32\" /> <link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\" /> <link"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "350"
},
"excerpt": "32x32\" /> <link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\" /> <link"
},
{
"ruleID": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
"what": "A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.",
"ordinalSeverity": 2,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "351"
},
"excerpt": "2x192\" /> <link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\" /> <meta"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "LINK",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "351"
},
"excerpt": "2x192\" /> <link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\" /> <meta"
},
{
"ruleID": "Attribute name not allowed on element meta at this point.",
"what": "Attribute name not allowed on element meta at this point.",
"ordinalSeverity": 2,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "352"
},
"excerpt": "0.jpg\" /> <meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" /> </hea"
},
{
"ruleID": "Element meta is missing one or more of the following attributes: itemprop, property.",
"what": "Element meta is missing one or more of the following attributes: itemprop, property.",
"ordinalSeverity": 2,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "352"
},
"excerpt": "0.jpg\" /> <meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" /> </hea"
},
{
"ruleID": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"what": "Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.",
"ordinalSeverity": -1,
"tagName": "META",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "352"
},
"excerpt": "0.jpg\" /> <meta name=\"msapplication-TileImage\" content=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-270x270.jpg\" /> </hea"
},
{
"ruleID": "Stray end tag head.",
"what": "Stray end tag head.",
"ordinalSeverity": 2,
"tagName": "BODY",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "353"
},
"excerpt": "0.jpg\" /> </head> <body"
},
{
"ruleID": "Start tag body seen but an element of the same type was already open.",
"what": "Start tag body seen but an element of the same type was already open.",
"ordinalSeverity": 2,
"tagName": "BODY",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "354"
},
"excerpt": "> </head> <body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz\"> <"
},
{
"ruleID": "Cannot recover after last error. Any further errors will be ignored.",
"what": "Cannot recover after last error. Any further errors will be ignored.",
"ordinalSeverity": 3,
"tagName": "BODY",
"id": "",
"location": {
"doc": "source",
"type": "line",
"spec": "354"
},
"excerpt": "> </head> <body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar astra-3.7.10 ast-normal-title-enabled brz\"> <"
}
]
},
"endTime": 1687099526983
},
{
"type": "test",
"which": "qualWeb",
"withNewContent": false,
"startTime": 1687099526983,
"url": "https://joepatterson.com/",
"what": "QualWeb",
"result": {
"type": "evaluation",
"system": {
"name": "QualWeb",
"description": "QualWeb is an automatic accessibility evaluator for webpages.",
"version": "3.0.0",
"homepage": "http://www.qualweb.di.fc.ul.pt/",
"date": "2023-06-18 14:45:28",
"hash": "4d4df931257f15a0febc57e078572f10d1b1a648e676e1bd8aaea0741f200ba696b907b4873ec93b93f926cbbbebd88e9d393647b8760689d13d7ddbd07cd5d9",
"page": {
"viewport": {
"mobile": false,
"landscape": true,
"userAgent": "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) HeadlessChrome/100.0.4889.0 Safari/537.36",
"resolution": {
"width": 1366,
"height": 768
}
}
}
},
"metadata": {
"passed": 23,
"warning": 11,
"failed": 12,
"inapplicable": 79
},
"modules": {
"act-rules": {
"type": "act-rules",
"metadata": {
"passed": 9,
"warning": 8,
"failed": 5,
"inapplicable": 45
},
"assertions": {
"QW-ACT-R63": {
"name": "Document has a landmark with non-repeated content",
"code": "QW-ACT-R63",
"mapping": "b40fd1",
"description": "This rule checks that each page has an element with a landmark semantic role starting with non-repeated content",
"metadata": {
"target": {
"element": "html"
},
"success-criteria": [],
"related": [],
"url": "https://act-rules.github.io/rules/b40fd1",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 0,
"warning": 1,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "Check either there is no non-repeated content after repeated content or there exists an element for which all the following are true: - the element has semantic role inheriting from landmark; and - the first perceivable content (in tree order in the flat tree) which is an inclusive descendant of the element is non-repeated content after repeated content; and - the element is included in the accessibility tree."
},
"results": [
{
"verdict": "warning",
"description": "Check either there is no non-repeated content after repeated content or there exists an element for which all the following are true: - the element has semantic role inheriting from landmark; and - the first perceivable content (in tree order in the flat tree) which is an inclusive descendant of the element is non-repeated content after repeated content; and - the element is included in the accessibility tree.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>",
"pointer": "html"
}
],
"attributes": []
}
]
},
"QW-ACT-R64": {
"name": "Document has heading for non-repeated content",
"code": "QW-ACT-R64",
"mapping": "047fe0",
"description": "This rule checks that the non-repeated content contains a heading",
"metadata": {
"target": {
"element": "html"
},
"success-criteria": [],
"related": [
"H69"
],
"url": "https://act-rules.github.io/rules/047fe0",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 0,
"warning": 1,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "Check either there is no non-repeated content after repeated content or there exists an element for which all the following are true: - the element is non-repeated content after repeated content; and - the element has a semantic role of heading; and - the element is visible; and - the element is included in the accessibility tree."
},
"results": [
{
"verdict": "warning",
"description": "Check either there is no non-repeated content after repeated content or there exists an element for which all the following are true: - the element is non-repeated content after repeated content; and - the element has a semantic role of heading; and - the element is visible; and - the element is included in the accessibility tree.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>",
"pointer": "html"
}
],
"attributes": []
}
]
},
"QW-ACT-R73": {
"name": "Block of repeated content is collapsible",
"code": "QW-ACT-R73",
"mapping": "3e12e1",
"description": "This rule checks that repeated blocks of content are collapsible.",
"metadata": {
"target": {
"element": "html"
},
"success-criteria": [],
"related": [
"SCR28"
],
"url": "https://act-rules.github.io/rules/3e12e1",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 0,
"warning": 1,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "For each block of repeated content in each test target, which is before (in the flat tree) at least one node of non-repeated content after repeated content, check that all the following are true: - there exists an instrument to make all nodes in this block not visible; and - there exists an instrument to remove all nodes in this block from the accessibility tree."
},
"results": [
{
"verdict": "warning",
"description": "For each block of repeated content in each test target, which is before (in the flat tree) at least one node of non-repeated content after repeated content, check that all the following are true: - there exists an instrument to make all nodes in this block not visible; and - there exists an instrument to remove all nodes in this block from the accessibility tree.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>",
"pointer": "html"
}
],
"attributes": []
}
]
},
"QW-ACT-R74": {
"name": "Document has an instrument to move focus to non-repeated content",
"code": "QW-ACT-R74",
"mapping": "ye5d6e",
"description": "This rule checks that there is an instrument to move focus to non-repeated content in the page.",
"metadata": {
"target": {
"element": "html"
},
"success-criteria": [],
"related": [
"G1",
"G123",
"G124"
],
"url": "https://act-rules.github.io/rules/ye5d6e",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 0,
"warning": 1,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "The page has one or more instrument(s) to move focus. Check if any of these instrument(s) is being used before a block of repeated content, and the focus is moved to just before a block of non-repeated content."
},
"results": [
{
"verdict": "warning",
"description": "The page has one or more instrument(s) to move focus. Check if any of these instrument(s) is being used before a block of repeated content, and the focus is moved to just before a block of non-repeated content.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>",
"pointer": "html"
}
],
"attributes": []
}
]
},
"QW-ACT-R12": {
"name": "Link has accessible name",
"code": "QW-ACT-R12",
"mapping": "c487ae",
"description": "This rule checks that each link has an accessible name.",
"metadata": {
"target": {
"element": [
"a[href]",
"area[href]"
],
"attributes": [
"role='link'"
]
},
"success-criteria": [
{
"name": "2.4.4",
"level": "A",
"principle": "Operable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/link-purpose-in-context",
"url_tr": "https://www.w3.org/TR/WCAG21/#link-purpose-in-context"
},
{
"name": "2.4.9",
"level": "AAA",
"principle": "Operable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/link-purpose-link-only",
"url_tr": "https://www.w3.org/TR/WCAG21/#link-purpose-link-only"
},
{
"name": "4.1.2",
"level": "A",
"principle": "Robust",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/name-role-value",
"url_tr": "https://www.w3.org/TR/WCAG21/#name-role-value"
}
],
"related": [
"G91"
],
"url": "https://act-rules.github.io/rules/c487ae",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 18,
"warning": 0,
"failed": 3,
"inapplicable": 0,
"outcome": "failed",
"description": "The test target doesn't have an accessible name, or it's empty ('')."
},
"results": [
{
"verdict": "failed",
"description": "The test target doesn't have an accessible name, or it's empty ('').",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)",
"accessibleName": ""
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target doesn't have an accessible name, or it's empty ('').",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)",
"accessibleName": ""
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target doesn't have an accessible name, or it's empty ('').",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1)",
"accessibleName": ""
}
],
"attributes": []
}
]
},
"QW-ACT-R18": {
"name": "`id` attribute value is unique",
"code": "QW-ACT-R18",
"mapping": "3ea0c8",
"description": "This rule checks that all id attribute values on a single page are unique.",
"metadata": {
"target": {
"element": "*"
},
"success-criteria": [
{
"name": "4.1.1",
"level": "A",
"principle": "Robust",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/parsing.html",
"url_tr": "https://www.w3.org/TR/WCAG21/#parsing"
}
],
"related": [
"H93"
],
"url": "https://act-rules.github.io/rules/3ea0c8",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 67,
"warning": 0,
"failed": 3,
"inapplicable": 0,
"outcome": "failed",
"description": "Several elements have the same `id` attribute."
},
"results": [
{
"verdict": "failed",
"description": "Several elements have the same `id` attribute.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<script type=\"text/javascript\" id=\"www-widgetapi-script\" src=\"https://www.youtube.com/s/player/6ed0d907/www-widgetapi.vflset/www-widgetapi.js\" async=\"\"></script>",
"pointer": "html > head:nth-child(1) > script:nth-child(25)"
},
{
"htmlCode": "<script type=\"text/javascript\" id=\"www-widgetapi-script\" src=\"https://www.youtube.com/s/player/6ed0d907/www-widgetapi.vflset/www-widgetapi.js\" async=\"\"></script>",
"pointer": "html > head:nth-child(1) > script:nth-child(27)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Several elements have the same `id` attribute.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\"> </g>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1)"
},
{
"htmlCode": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\"> </g>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Several elements have the same `id` attribute.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(1)"
},
{
"htmlCode": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(2)"
},
{
"htmlCode": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(1)"
},
{
"htmlCode": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(2)"
}
],
"attributes": []
}
]
},
"QW-ACT-R62": {
"name": "Element in sequential focus order has visible focus",
"code": "QW-ACT-R62",
"mapping": "oj04fd",
"description": "This rule checks that each element in sequential focus order has some visible focus indication.",
"metadata": {
"target": {
"element": "*"
},
"success-criteria": [
{
"name": "2.4.7",
"level": "AA",
"principle": "Operable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/focus-visible.html",
"url_tr": "https://www.w3.org/TR/WCAG21/#focus-visible"
}
],
"related": [],
"url": "https://act-rules.github.io/rules/oj04fd",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 0,
"warning": 34,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "Check if the element has some visible focus indication"
},
"results": [
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">Home</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">Meet Joe</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">News</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">AD5</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">Issues</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">DONATE</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">$5</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">$10</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">$25</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">$50</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">$75</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">OTHER</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email *\" data-placeholder=\"Email *\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj\" data-custom-id=\"nxouluvbretczsumlwfttgzfltqnntvlwvaf\">SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationFrame(t.triggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this.start=t);var n=t-thi …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\">Learn More</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email*\" data-placeholder=\"Email*\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-dyvgx\" data-custom-id=\"pctxnochcdlwubleyhhicvdleifnqiyrttuh\">Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationFrame(t.triggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this. …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > button:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">Home</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">Meet Joe</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">News</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">AD5</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">Issues</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email Updates\" data-placeholder=\"Email Updates\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-rplcf\" data-custom-id=\"urngpgulgkggkfoivjalbjunpabjeeujtqmh\">SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationFrame(t.triggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this.start= …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if the element has some visible focus indication",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
}
]
},
"QW-ACT-R41": {
"name": "Error message describes invalid form field value",
"code": "QW-ACT-R41",
"mapping": "36b590",
"description": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"metadata": {
"target": {
"element": [
"input",
"select",
"textarea",
"*[role]"
]
},
"success-criteria": [
{
"name": "3.3.1",
"level": "A",
"principle": "Understandable",
"url": "https://www.w3.org/TR/WCAG21/#error-identification",
"url_tr": "https://www.w3.org/TR/WCAG21/#error-identification"
}
],
"related": [],
"url": "https://act-rules.github.io/rules/36b590",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 0,
"warning": 10,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error."
},
"results": [
{
"verdict": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email *\" data-placeholder=\"Email *\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email*\" data-placeholder=\"Email*\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that text error messages provided, identify the cause of the error or how to fix the error.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@"]+)*)|(".+"))@((\\[[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email Updates\" data-placeholder=\"Email Updates\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
}
],
"attributes": []
}
]
},
"QW-ACT-R17": {
"name": "Image has accessible name",
"code": "QW-ACT-R17",
"mapping": "23a2a8",
"description": "This rule checks that each image that is not marked as decorative, has an accessible name.",
"metadata": {
"target": {
"element": "img"
},
"success-criteria": [
{
"name": "1.1.1",
"level": "A",
"principle": "Understandable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/non-text-content.html",
"url_tr": "https://www.w3.org/TR/WCAG21/#non-text-content"
}
],
"related": [
"G94",
"G95"
],
"url": "https://act-rules.github.io/rules/23a2a8",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 3,
"warning": 0,
"failed": 1,
"inapplicable": 0,
"outcome": "failed",
"description": "The test target doesn't have an accessible name."
},
"results": [
{
"verdict": "failed",
"description": "The test target doesn't have an accessible name.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">",
"pointer": "html > body:nth-child(2) > img:nth-child(1)"
}
],
"attributes": []
}
]
},
"QW-ACT-R37": {
"name": "Text has minimum contrast",
"code": "QW-ACT-R37",
"mapping": "afw4f7",
"description": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"metadata": {
"target": {
"element": [
"*"
]
},
"success-criteria": [
{
"name": "1.4.3",
"level": "A",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/contrast-minimum.html",
"url_tr": "https://www.w3.org/TR/WCAG21/#contrast-minimum"
},
{
"name": "1.4.6",
"level": "AA",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/contrast-enhanced.html",
"url_tr": "https://www.w3.org/TR/WCAG21/#contrast-enhanced"
}
],
"related": [],
"url": "https://act-rules.github.io/rules/afw4f7",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 16,
"warning": 0,
"failed": 10,
"inapplicable": 0,
"outcome": "failed",
"description": "Element has contrast ratio lower than minimum."
},
"results": [
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Home</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">News</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">AD5</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Issues</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Home</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">News</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">AD5</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Issues</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
}
]
},
"QW-ACT-R76": {
"name": "Text has enhanced contrast",
"code": "QW-ACT-R76",
"mapping": "09o5cg",
"description": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"metadata": {
"target": {
"element": "*"
},
"success-criteria": [
{
"name": "1.4.6",
"level": "AAA",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/contrast-enhanced.html",
"url_tr": "https://www.w3.org/TR/WCAG21/#contrast-enhanced"
}
],
"related": [
"G17",
"G18"
],
"url": "https://act-rules.github.io/rules/09o5cg",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 14,
"warning": 0,
"failed": 12,
"inapplicable": 0,
"outcome": "failed",
"description": "Element has contrast ratio lower than minimum."
},
"results": [
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Home</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">News</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">AD5</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Issues</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Home</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">News</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">AD5</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Issues</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Element has contrast ratio lower than minimum.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
}
]
},
"QW-ACT-R75": {
"name": "Bypass Blocks of Repeated Content",
"code": "QW-ACT-R75",
"mapping": "cf77f2",
"description": "This rule checks that each page has a mechanism to bypass repeated blocks of content.",
"metadata": {
"target": {
"element": "html"
},
"success-criteria": [
{
"name": "2.4.1",
"level": "A",
"principle": "Operable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/bypass-blocks.html",
"url_tr": "https://www.w3.org/TR/WCAG21/#bypass-blocks"
}
],
"related": [
"G1",
"G123",
"G124",
"H69",
"SCR28"
],
"url": "https://act-rules.github.io/rules/cf77f2",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 0,
"warning": 1,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "The rule can't tell because of the rule QW-ACT-R63"
},
"results": [
{
"verdict": "warning",
"description": "The rule can't tell because of the rule QW-ACT-R63",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body>Joe Patterson\n\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\n\t\t\t{\"@context\":\"https:\\/\\/schema.org\",\"@graph\":[{\"@type\":\"WebSite\",\"@id\":\"https:\\/\\/joepatterson.com\\/#website\",\"url\":\"https:\\/\\/joepatterson.com\\/\",\"name\":\"Joe Patterson\",\"inLanguage\":\"en-US\",\"publisher\":{\"@id\":\"https:\\/\\/joepatterson.com\\/#organization\"},\"potentialAction\":{\"@type\":\"SearchAction\",\"target\":{\"@type\":\"EntryPoint\",\"urlTemplate\":\"https:\\/\\/joepatterson.com\\/?s={search_term_string}\"},\"query-input\":\"required name=search_term_string\"}},{\"@type\":\"Organization\",\"@id\":\"https:\\/\\/joepatterson.com\\/#organization\",\"name\":\"Joe Pat …",
"pointer": "html"
}
],
"attributes": []
}
]
},
"QW-ACT-R40": {
"name": "Zoomed text node is not clipped with CSS overflow",
"code": "QW-ACT-R40",
"mapping": "59br37",
"description": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"metadata": {
"target": {
"element": "*:text()"
},
"success-criteria": [
{
"name": "1.4.4",
"level": "AA",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/resize-text.html",
"url_tr": "https://www.w3.org/TR/WCAG21/#resize-text"
}
],
"related": [],
"url": "https://act-rules.github.io/rules/59br37",
"type": [
"ACTRule",
"TestCase"
],
"a11yReq": [],
"passed": 0,
"warning": 34,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow."
},
"results": [
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Home</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">News</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">AD5</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Issues</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">DONATE</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(2)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color3\">THANK YOU!</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color3\">-Joe Patterson </span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color8\">STAND WITH JOE:</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">$5</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">$10</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">$25</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">$50</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">$75</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">OTHER</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color1\">Meet Joe Patterson</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">Learn More</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<strong class=\"brz-cp-color8\">Endorse Joe</strong>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">Endorse Joe!</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > button:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Home</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Meet Joe</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">News</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">AD5</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span\">Issues</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color8\">Paid for by Joe Patterson for Assembly 2024 FPPC ID</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color8 brz-pre-population-visible\"># </span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(2)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check if each ancestor or the text node is not clipped by overflow.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color8\">1456524</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(3)"
}
],
"attributes": []
}
]
}
}
},
"wcag-techniques": {
"type": "wcag-techniques",
"metadata": {
"passed": 3,
"warning": 2,
"failed": 6,
"inapplicable": 23
},
"assertions": {
"QW-WCAG-T23": {
"name": "Adding a link at the top of each page that goes directly to the main content area",
"code": "QW-WCAG-T23",
"mapping": "G1",
"description": "The objective of this technique is to provide a mechanism to bypass blocks of material that are repeated on multiple Web pages by skipping directly to the main content of the Web page.",
"metadata": {
"target": {
"element": "body"
},
"success-criteria": [
{
"name": "2.4.1",
"level": "A",
"principle": "Operable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/bypass-blocks"
}
],
"related": [
"G123",
"G124"
],
"url": "https://www.w3.org/WAI/WCAG21/Techniques/general/G1",
"passed": 0,
"warning": 0,
"failed": 1,
"inapplicable": 0,
"outcome": "failed",
"description": "The first focusable control on the Web page does not links to local content."
},
"results": [
{
"verdict": "failed",
"description": "The first focusable control on the Web page does not links to local content.",
"resultCode": "F3",
"elements": [
{
"htmlCode": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
}
]
},
"QW-WCAG-T21": {
"name": "Failure of Success Criteria 2.4.4, 2.4.9 and 4.1.2 due to not providing an accessible name for an image which is the only content in a link",
"code": "QW-WCAG-T21",
"mapping": "F89",
"description": "This technique checks the text alternative of images which are the only content of a link",
"metadata": {
"target": {
"parent": "a",
"element": "img"
},
"success-criteria": [
{
"name": "2.4.4",
"level": "A",
"principle": "Operable",
"url": "https://www.w3.org/TR/UNDERSTANDING-WCAG20/navigation-mechanisms-refs.html"
},
{
"name": "2.4.9",
"level": "AAA",
"principle": "Operable",
"url": "https://www.w3.org/TR/UNDERSTANDING-WCAG20/navigation-mechanisms-link.html"
},
{
"name": "4.1.2",
"level": "A",
"principle": "Robust",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/name-role-value"
}
],
"related": [
"H2",
"H30",
"ARIA7",
"ARIA8"
],
"url": "https://www.w3.org/WAI/WCAG21/Techniques/failures/F89",
"passed": 0,
"warning": 0,
"failed": 1,
"inapplicable": 0,
"outcome": "failed",
"description": "The image doesn't have an accessible name."
},
"results": [
{
"verdict": "failed",
"description": "The image doesn't have an accessible name.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
}
]
},
"QW-WCAG-T15": {
"name": "Using the link element and navigation tools",
"code": "QW-WCAG-T15",
"mapping": "H59",
"description": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"metadata": {
"target": {
"element": "link"
},
"success-criteria": [
{
"name": "2.4.5",
"level": "AA",
"principle": "Operable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/multiple-ways"
},
{
"name": "2.4.8",
"level": "AAA",
"principle": "Operable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/location"
}
],
"related": [
"G1",
"G63",
"G64",
"G123"
],
"url": "https://www.w3.org/WAI/WCAG21/Techniques/html/H59",
"passed": 6,
"warning": 6,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>"
},
"results": [
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"profile\" href=\"http://gmpg.org/xfn/11\">",
"pointer": "html > head:nth-child(1) > link:nth-child(2)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"pingback\" href=\"https://joepatterson.com/xmlrpc.php\">",
"pointer": "html > head:nth-child(1) > link:nth-child(3)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">",
"pointer": "html > head:nth-child(1) > link:nth-child(31)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"stylesheet\" id=\"astra-theme-css-css\" href=\"https://joepatterson.com/wp-content/themes/astra/assets/css/minified/main.min.css?ver=3.7.10\" media=\"all\">",
"pointer": "html > head:nth-child(1) > link:nth-child(36)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"stylesheet\" id=\"wp-block-library-css\" href=\"https://joepatterson.com/wp-includes/css/dist/block-library/style.min.css?ver=6.2.2\" media=\"all\">",
"pointer": "html > head:nth-child(1) > link:nth-child(38)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"stylesheet\" id=\"brizy-asset-google-10-css\" class=\"brz-link brz-link-google\" type=\"text/css\" href=\"https://fonts.googleapis.com/css?family=Overpass%3A100%2C100italic%2C200%2C200italic%2C300%2C300italic%2Cregular%2Citalic%2C600%2C600italic%2C700%2C700italic%2C800%2C800italic%2C900%2C900italic%7CMontserrat%3A100%2C100italic%2C200%2C200italic%2C300%2C300italic%2Cregular%2Citalic%2C500%2C500italic%2C600%2C600italic%2C700%2C700italic%2C800%2C800italic%2C900%2C900italic%7CLato%3A100%2C100italic%2C300%2C300italic%2Cregular%2Citalic%2C700%2C700italic%2C900%2C900italic%7CRed+Hat+Text%3Aregular%2Citalic%2C500%2C500italic%2C700%2C700italic&subset=arabic%2Cbengali%2Ccyrillic%2Ccyrillic-ext …",
"pointer": "html > head:nth-child(1) > link:nth-child(40)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"stylesheet\" id=\"brizy-asset-group-1-20-css\" class=\"brz-link brz-link-preview-lib\" data-group=\"group-1\" href=\"https://joepatterson.com/wp-content/plugins/brizy/public/editor-build/232-wp/editor/css/group-1.css?ver=2.3.35\" media=\"all\">",
"pointer": "html > head:nth-child(1) > link:nth-child(41)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"stylesheet\" id=\"brizy-asset-group-2-21-css\" class=\"brz-link brz-link-preview-lib-pro\" data-group=\"group-2\" href=\"https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/group-2-pro.css?ver=2.3.28\" media=\"all\">",
"pointer": "html > head:nth-child(1) > link:nth-child(42)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"stylesheet\" id=\"brizy-asset-main-30-css\" class=\"brz-link brz-link-preview-pro\" href=\"https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/preview.pro.css?ver=2.3.28\" media=\"all\">",
"pointer": "html > head:nth-child(1) > link:nth-child(43)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"https://api.w.org/\" href=\"https://joepatterson.com/wp-json/\">",
"pointer": "html > head:nth-child(1) > link:nth-child(48)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"EditURI\" type=\"application/rsd+xml\" title=\"RSD\" href=\"https://joepatterson.com/xmlrpc.php?rsd\">",
"pointer": "html > head:nth-child(1) > link:nth-child(50)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"wlwmanifest\" type=\"application/wlwmanifest+xml\" href=\"https://joepatterson.com/wp-includes/wlwmanifest.xml\">",
"pointer": "html > head:nth-child(1) > link:nth-child(51)"
}
],
"attributes": []
},
{
"verdict": "inapplicable",
"description": "The element doesn't contain a rel attribute or doesn't pertains navigation.",
"resultCode": "I2",
"elements": [
{
"htmlCode": "<link rel=\"shortlink\" href=\"https://joepatterson.com/\">",
"pointer": "html > head:nth-child(1) > link:nth-child(53)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
"resultCode": "RC1",
"elements": [
{
"htmlCode": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//ajax.googleapis.com\">",
"pointer": "html > body:nth-child(2) > link:nth-child(7)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
"resultCode": "RC1",
"elements": [
{
"htmlCode": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">",
"pointer": "html > body:nth-child(2) > link:nth-child(8)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
"resultCode": "RC1",
"elements": [
{
"htmlCode": "<link class=\"brz-link brz-link-google-preconnect\" rel=\"preconnect\" href=\"https://fonts.gstatic.com/\" crossorigin=\"\">",
"pointer": "html > body:nth-child(2) > link:nth-child(9)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
"resultCode": "RC1",
"elements": [
{
"htmlCode": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\">",
"pointer": "html > body:nth-child(2) > link:nth-child(12)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
"resultCode": "RC1",
"elements": [
{
"htmlCode": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\">",
"pointer": "html > body:nth-child(2) > link:nth-child(13)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "The element is not contained in the head element. Verify if this link is used for navigation, and if it is, it must be inside the <head>",
"resultCode": "RC1",
"elements": [
{
"htmlCode": "<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\">",
"pointer": "html > body:nth-child(2) > link:nth-child(14)"
}
],
"attributes": []
}
]
},
"QW-WCAG-T32": {
"name": "Using ol, ul and dl for lists or groups of links",
"code": "QW-WCAG-T32",
"mapping": "H48",
"description": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
"metadata": {
"target": {
"element": [
"li",
"dd",
"dt"
]
},
"success-criteria": [
{
"name": "1.3.1",
"level": "A",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/info-and-relationships"
}
],
"related": [
"H40"
],
"url": "https://www.w3.org/WAI/WCAG21/Techniques/html/H48",
"passed": 0,
"warning": 6,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list."
},
"results": [
{
"verdict": "warning",
"description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<ul class=\"brz-menu__ul brz-mm-listview\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-mm-menu__item brz-mm-menu__item-empty brz-mm-menu__item--current brz-mm-listitem\" data-menu-item-id=\"b80377d0ea164df79e92847fe9d7db93\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item brz-mm-listitem__text\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(1) > a:nth-child(1)\" _cssrules=\"true\"><span class=\"brz-span\" _sele …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<ul class=\"brz-mm-menu__sub-menu brz-menu__ul--has-dropdown brz-mm-listview\"><li class=\"brz-mm-menu__item brz-mm-menu__item-empty brz-mm-listitem\" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page brz-mm-listitem__text\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"external\" id=\"\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > div:nth-child(3) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)\" _cssrules=\"true\"><span class=\"brz-span\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > div:nth-child(3) > ul:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<ul class=\"brz-menu__ul\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-menu__item brz-menu__item--current\" data-menu-item-id=\"b80377d0ea164df79e92847fe9d7db93\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" _cssrules=\"true\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-c …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22%2C%22tablet%22%3A%22bottom-start%22%2C%22mobile%22%3A%22bottom-start%22%7D%7D\" class=\"brz-menu__dropdown brz-menu__sub-menu\" style=\"--offset: 5px; position: absolute; inset: 0px auto auto 0px; margin: 0px; transform: translate(0px, 44px);\" data-popper-placement=\"bottom-start\"><li class=\"brz-menu__item\" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"e …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > ul:nth-child(2)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<ul class=\"brz-menu__ul\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-menu__item brz-menu__item--current\" data-menu-item-id=\"b80377d0ea164df79e92847fe9d7db93\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" _cssrules=\"true\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "Check that content that has the visual appearance of a list (with or without bullets) is marked as an unordered list.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22%2C%22tablet%22%3A%22bottom-start%22%2C%22mobile%22%3A%22bottom-start%22%7D%7D\" class=\"brz-menu__dropdown brz-menu__sub-menu\" style=\"--offset: 5px; position: absolute; inset: auto auto 0px 0px; margin: 0px; transform: translate(0px, -43px);\" data-popper-reference-hidden=\"\" data-popper-escaped=\"\" data-popper-placement=\"top-start\"><li class=\"brz-menu__item\" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://jo …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > ul:nth-child(2)"
}
],
"attributes": []
}
]
},
"QW-WCAG-T19": {
"name": "Providing submit buttons",
"code": "QW-WCAG-T19",
"mapping": "H32",
"description": "The objective of this technique is to provide a mechanism that allows users to explicitly request changes of context. The intended use of a submit button is to generate an HTTP request that submits data entered in a form, so it is an appropriate control to use for causing a change of context.",
"metadata": {
"target": {
"element": "form"
},
"success-criteria": [
{
"name": "3.2.2",
"level": "A",
"principle": "Understandable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/on-input"
}
],
"related": [
"G80",
"H36",
"H84"
],
"url": "https://www.w3.org/WAI/WCAG21/Techniques/html/H32",
"passed": 0,
"warning": 0,
"failed": 3,
"inapplicable": 0,
"outcome": "failed",
"description": "Form tag doesn't contain any of the following elements input[type~='submit image'], button[type='submit']."
},
"results": [
{
"verdict": "failed",
"description": "Form tag doesn't contain any of the following elements input[type~='submit image'], button[type='submit'].",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"dskyguesfdwsuhockwwasaportijqvjngwsh\" data-project-id=\"9f61f1ac83161ffb9c881a4dedac45c2\" data-success=\"\" data-error=\"\" data-redirect=\"/confirmation/\">SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationF …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Form tag doesn't contain any of the following elements input[type~='submit image'], button[type='submit'].",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"fbtlofiblnoutrunfzizbsdvloekmnvpisxn\" data-project-id=\"9f61f1ac83161ffb9c881a4dedac45c2\" data-success=\"Your endorsement was sent. Thank you.\" data-error=\"There was an error. Please\" data-redirect=\"/confirmation/\">Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "Form tag doesn't contain any of the following elements input[type~='submit image'], button[type='submit'].",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"fonhcxfbmwbbacpwvgmiprkqrpdqrdbvdnrz\" data-project-id=\"9f61f1ac83161ffb9c881a4dedac45c2\" data-success=\"\" data-error=\"\" data-redirect=\"\">SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationFrame(t.trigger …",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
}
],
"attributes": []
}
]
},
"QW-WCAG-T28": {
"name": "Using `percent, em, names` for font sizes",
"code": "QW-WCAG-T28",
"mapping": "C121314",
"description": "This technique checks that all font-size attribute uses percent, em or names.",
"metadata": {
"target": {
"element": "*",
"attributes": "font-size"
},
"success-criteria": [
{
"name": "1.4.4",
"level": "AA",
"principle": "Perceivable",
"url": "https://www.w3.org/TR/UNDERSTANDING-WCAG20/visual-audio-contrast-scale.html"
},
{
"name": "1.4.5",
"level": "AA",
"principle": "Perceivable",
"url": "https://www.w3.org/TR/UNDERSTANDING-WCAG20/visual-audio-contrast-text-presentation.html"
},
{
"name": "1.4.8",
"level": "AAA",
"principle": "Perceivable",
"url": "https://www.w3.org/TR/UNDERSTANDING-WCAG20/visual-audio-contrast-visual-presentation.html"
},
{
"name": "1.4.9",
"level": "AAA",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/GL/UNDERSTANDING-WCAG20/visual-audio-contrast-text-images.html"
}
],
"related": [
"C12",
"C13",
"C14"
],
"url": {
"C12": "https://www.w3.org/WAI/WCAG21/Techniques/css/C12",
"C13": "https://www.w3.org/WAI/WCAG21/Techniques/css/C13",
"C14": "https://www.w3.org/WAI/WCAG21/Techniques/css/C14"
},
"passed": 16,
"warning": 0,
"failed": 50,
"inapplicable": 0,
"outcome": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag."
},
"results": [
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-icon css-3z2g66\"> </span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": [
"48px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-pzxzi\" data-uniq-id=\"ktmas\" data-generated-css=\"brz-css-xvlfv\"></p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"22px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\"> </svg>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1)"
}
],
"attributes": [
"32px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-zctmh\" data-uniq-id=\"hlkbv\" data-generated-css=\"brz-css-yeiqu\">HOME</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"var(--brz-heading1FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">DONATE</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": [
"30px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-css-oheuj\" data-type=\"glyph\" data-name=\"tail-right\"></svg>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > svg:nth-child(1)"
}
],
"attributes": [
"16px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-icon css-1v9psv1\"></span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > span:nth-child(1)"
}
],
"attributes": [
"48px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\">THANK YOU!</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"46px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-vtphm\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"> </p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"var(--brz-heading3FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2)"
}
],
"attributes": [
"var(--brz-heading3FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\">-Joe Patterson </p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3)"
}
],
"attributes": [
"var(--brz-heading3FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-icon css-1cnr1ql\"></span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > span:nth-child(1)"
}
],
"attributes": [
"48px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-lkuyo\" data-generated-css=\"brz-css-kokqw\" data-uniq-id=\"hpxfi\">JOE PATTERSON</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"84px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-mkkan\" data-uniq-id=\"lwuac\" data-generated-css=\"brz-css-erjeq\">Your voice in the State Assembly.</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"44px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdggtybzbtscl\">$5</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": [
"24px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufznyxypipympv\">$10</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
}
],
"attributes": [
"24px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurwjvjsywyumae\">$25</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
}
],
"attributes": [
"24px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-cbllz\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yemcvnewgngfymiotxewwyjzajhaeldnceah\">OTHER</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
}
],
"attributes": [
"24px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p data-uniq-id=\"qctya\" data-generated-css=\"brz-css-oooyn\" class=\"brz-css-yhukw\">STAND WITH JOE:</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"27px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">$5</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": [
"24px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">$10</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
}
],
"attributes": [
"24px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">$25</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
}
],
"attributes": [
"24px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">$50</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
}
],
"attributes": [
"24px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">$75</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1)"
}
],
"attributes": [
"24px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">OTHER</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1)"
}
],
"attributes": [
"24px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p data-uniq-id=\"hwwdz\" data-generated-css=\"brz-css-owosm\" class=\"brz-css-dbkfe\">JOIN THE TEAM</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"var(--brz-heading1FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-gjenq\"></div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
}
],
"attributes": [
"18px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-sqjjw\"></div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2)"
}
],
"attributes": [
"18px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk\"></div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3)"
}
],
"attributes": [
"18px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-solsx\"></div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4)"
}
],
"attributes": [
"18px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-xnabq\"></div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5)"
}
],
"attributes": [
"18px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\">Meet Joe Patterson</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"56px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"20px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\">Learn More</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
}
],
"attributes": [
"25px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-bklfk\" data-uniq-id=\"qxpfh\" data-generated-css=\"brz-css-owucl\">Endorse Joe</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"44px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-ilwyl\"></div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
}
],
"attributes": [
"18px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-odtpn\"></div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2)"
}
],
"attributes": [
"18px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-fyenv\"></div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3)"
}
],
"attributes": [
"18px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-cbrxq\"></div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4)"
}
],
"attributes": [
"18px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-ztibp brz-css-liimk brz-css-vgqwm\"></div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
}
],
"attributes": [
"18px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-icon css-1yqt0eo\"></span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": [
"32px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-span brz-icon css-1ldonqd\"></span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": [
"32px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\"> </svg>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1)"
}
],
"attributes": [
"32px"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-rjztm\" data-uniq-id=\"hlkbv\" data-generated-css=\"brz-css-yeiqu\">HOME</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"var(--brz-heading1FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-xquao\" data-generated-css=\"brz-css-mqzvf\" data-uniq-id=\"fmuwc\">MEET JOE</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"var(--brz-heading1FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-yjyph\" data-uniq-id=\"lejsp\" data-generated-css=\"brz-css-fumnn\">NEWS</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"var(--brz-heading1FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-bwxye\" data-generated-css=\"brz-css-tujgm\" data-uniq-id=\"ulmaa\">AD5</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"var(--brz-heading1FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-wwpav\" data-uniq-id=\"qtxdk\" data-generated-css=\"brz-css-hhgpv\">ENDORSEMENTS</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"var(--brz-heading1FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-tbnau\" data-uniq-id=\"knloz\" data-generated-css=\"brz-css-opatl\">YARD SIGNS</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"var(--brz-heading1FontSize)"
]
},
{
"verdict": "failed",
"description": "This test target has a font-size css property using an absolute unit value with the important flag.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-dzpeg\" data-generated-css=\"brz-css-nsqiu\" data-uniq-id=\"dmvlt\">VOLUNTEER</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(7) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": [
"var(--brz-heading1FontSize)"
]
}
]
},
"QW-WCAG-T29": {
"name": "Specifying alignment either to the left or right in CSS",
"code": "QW-WCAG-T29",
"mapping": "C19",
"description": "This technique describes how to align blocks of text either left or right by setting the CSS text-align property.",
"metadata": {
"target": {
"element": "*",
"attributes": "text-align"
},
"success-criteria": [
{
"name": "1.4.8",
"level": "AAA",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/visual-presentation"
}
],
"related": [],
"url": "https://www.w3.org/WAI/WCAG21/Techniques/css/C19",
"passed": 24,
"warning": 0,
"failed": 2,
"inapplicable": 0,
"outcome": "failed",
"description": "This test target has a text-align css property not equal to justify."
},
"results": [
{
"verdict": "failed",
"description": "This test target has a text-align css property not equal to justify.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<style class=\"brz-style\">@media(min-width:991px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:991px) and (min-width:768px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:767px){.brz .brz-css-nkwmc{display:block;}}\n.brz .brz-css-mmmvq{padding:75px 0px 75px 0px;margin:0;}.brz .brz-css-mmmvq > .brz-bg{border:0px solid rgba(102, 115, 141, 0);border-radius:0;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-image{background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-image:after{content: \"\";background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-color{background-color:rgba(0, 0, 0, 0);background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-shape__top{background-size: 10 …",
"pointer": "html > body:nth-child(2) > style:nth-child(11)"
}
],
"attributes": [
"text-align: justify"
]
},
{
"verdict": "failed",
"description": "This test target has a text-align css property not equal to justify.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<style class=\"brz-style\">@media(min-width:991px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:991px) and (min-width:768px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:767px){.brz .brz-css-nkwmc{display:block;}}\n.brz .brz-css-mmmvq{padding:75px 0px 75px 0px;margin:0;}.brz .brz-css-mmmvq > .brz-bg{border:0px solid rgba(102, 115, 141, 0);border-radius:0;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-image{background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-image:after{content: \"\";background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-color{background-color:rgba(0, 0, 0, 0);background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-shape__top{background-size: 10 …",
"pointer": "html > body:nth-child(2) > style:nth-child(11)"
}
],
"attributes": [
"text-align: justify"
]
}
]
},
"QW-WCAG-T31": {
"name": "Failure of Success Criterion 1.4.3, 1.4.6 and 1.4.8 due to specifying foreground colors without specifying background colors or vice versa",
"code": "QW-WCAG-T31",
"mapping": "F24",
"description": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"metadata": {
"target": {
"element": "*",
"attributes": "text-decoration"
},
"success-criteria": [
{
"name": "1.4.3",
"level": "AA",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/contrast-minimum"
},
{
"name": "1.4.6",
"level": "AAA",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/contrast-enhanced"
},
{
"name": "1.4.8",
"level": "AAA",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/visual-presentation"
}
],
"related": [
"C23",
"C25"
],
"url": "https://www.w3.org/WAI/WCAG21/Techniques/failures/F24",
"passed": 35,
"warning": 0,
"failed": 23,
"inapplicable": 0,
"outcome": "failed",
"description": "The test target has a author defined color css property but not a background css property."
},
"results": [
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<noscript>\n<img height=\"1\" width=\"1\" style=\"display:none\" alt=\"fbpx\"\nsrc=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" />\n</noscript>",
"pointer": "html > body:nth-child(2) > noscript:nth-child(5)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a href=\"https://joepatterson.com/\" style=\"\" class=\"link--external is-empty brz-cp-color8\" data-brz-link-type=\"external\">HOME</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color3\">THANK YOU!</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color3\">-Joe Patterson </span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color8\">STAND WITH JOE:</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color1\">Meet Joe Patterson</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four children. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<strong class=\"brz-cp-color8\">Endorse Joe</strong>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color8\">Paid for by Joe Patterson for Assembly 2024 FPPC ID</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color8 brz-pre-population-visible\"># </span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(2)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-cp-color8\">1456524</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(3)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<span class=\"brz-mm-sronly\">Close menu</span>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > div:nth-child(10) > a:nth-child(1) > span:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a href=\"https://joepatterson.com/\" style=\"\" class=\"link--external is-empty brz-cp-color8\" data-brz-link-type=\"external\">HOME</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a href=\"/about/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">MEET JOE</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a href=\"/news/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">NEWS</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a href=\"/ad5/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">AD5</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a href=\"/endorsements/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">ENDORSEMENTS</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a href=\"/yard-sign/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">YARD SIGNS</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "failed",
"description": "The test target has a author defined color css property but not a background css property.",
"resultCode": "F1",
"elements": [
{
"htmlCode": "<a href=\"/yard-sign/\" style=\"\" class=\"link--external brz-cp-color8\" data-brz-link-type=\"external\">VOLUNTEER</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(7) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
}
],
"attributes": []
}
]
}
}
},
"best-practices": {
"type": "best-practices",
"metadata": {
"passed": 11,
"warning": 1,
"failed": 1,
"inapplicable": 11
},
"assertions": {
"QW-BP1": {
"name": "Using h1-h6 to identify headings",
"code": "QW-BP1",
"mapping": "H42",
"description": "It is recommended to use HTML and XHTML heading markup to provide semantic code for headings in the content",
"metadata": {
"target": {
"element": [
"h1",
"h2",
"h3",
"h4",
"h5",
"h6"
]
},
"success-criteria": [
{
"name": "1.3.1",
"level": "A",
"principle": "Perceivable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/info-and-relationships.html"
}
],
"related": [
"H69",
"G141",
"F2",
"F43"
],
"url": "https://www.w3.org/TR/WCAG20-TECHS/H42.html",
"passed": 0,
"warning": 0,
"failed": 1,
"inapplicable": 0,
"outcome": "failed",
"description": "This page doesn't use headings."
},
"results": [
{
"verdict": "failed",
"description": "This page doesn't use headings.",
"resultCode": "F1",
"elements": [],
"attributes": []
}
]
},
"QW-BP17": {
"name": "Adding a link at the beginning of a block of repeated content to go to the end of the block",
"code": "QW-BP17",
"mapping": "G123",
"description": "The objective of this technique is to provide a mechanism to bypass a block of material by skipping to the end of the block.",
"metadata": {
"target": {
"element": "a",
"attributes": "href"
},
"success-criteria": [
{
"name": "2.4.1",
"level": "A",
"principle": "Operable",
"url": "https://www.w3.org/WAI/WCAG21/Understanding/bypass-blocks"
}
],
"related": [
"G1",
"G124"
],
"url": "https://www.w3.org/WAI/WCAG21/Techniques/general/G123",
"passed": 0,
"warning": 3,
"failed": 0,
"inapplicable": 0,
"outcome": "warning",
"description": "This link skips a content block."
},
"results": [
{
"verdict": "warning",
"description": "This link skips a content block.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-mm-navbar__title\" href=\"#mm-1\">Main Menu</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
{
"htmlCode": "<div id=\"mm-1\" class=\"brz-mm-panel brz-mm-panel_opened\">Main MenuHomeMeet JoeToggle submenuTVNewsAD5Issues</div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "This link skips a content block.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a class=\"brz-mm-btn brz-mm-btn_next brz-mm-listitem__btn\" href=\"#mm-2\">Toggle submenu</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > a:nth-child(2)"
},
{
"htmlCode": "<div id=\"mm-2\" class=\"brz-mm-panel brz-mm-hidden\" aria-hidden=\"true\">TV</div>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > div:nth-child(3)"
}
],
"attributes": []
},
{
"verdict": "warning",
"description": "This link skips a content block.",
"resultCode": "W1",
"elements": [
{
"htmlCode": "<a href=\"#mm-0\">Close menu</a>",
"pointer": "html > body:nth-child(2) > div:nth-child(24) > div:nth-child(10) > a:nth-child(1)"
},
{
"htmlCode": "<div class=\"brz-root__container brz-reset-all brz-mm-page brz-mm-slideout\" id=\"mm-0\">Main MenuHomeMeet JoeToggle submenuTVNewsAD5IssuesHomeMeet JoeTVNewsAD5Issues\n HOMEDONATETHANK YOU! Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. -Joe Patterson JOE PATTERSONYour voice in the State Assembly.$5$10$25OTHERSTAND WITH JOE:$5$10$25$50$75OTHERJOIN THE TEAMSUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Mat …",
"pointer": "html > body:nth-child(2) > div:nth-child(24)"
}
],
"attributes": []
}
]
}
}
},
"counter": {
"type": "counter",
"data": {
"roles": {
"link": 70,
"document": 1,
"img": 1,
"none": 8,
"navigation": 3,
"list": 6,
"listitem": 18,
"region": 7,
"presentation": 3,
"graphics-document": 12,
"form": 3,
"textbox": 10,
"button": 3,
"separator": 1
},
"tags": {
"html": 1,
"head": 1,
"meta": 24,
"link": 25,
"title": 1,
"script": 33,
"style": 6,
"noscript": 2,
"body": 1,
"img": 4,
"svg": 20,
"defs": 8,
"filter": 8,
"fecolormatrix": 8,
"fecomponenttransfer": 8,
"fefuncr": 8,
"fefuncg": 8,
"fefuncb": 8,
"fefunca": 8,
"fecomposite": 8,
"div": 258,
"nav": 3,
"a": 45,
"span": 52,
"ul": 6,
"li": 18,
"section": 7,
"picture": 3,
"g": 13,
"path": 19,
"p": 21,
"br": 1,
"strong": 2,
"source": 2,
"form": 3,
"input": 10,
"button": 3,
"hr": 1,
"footer": 1
}
}
}
},
"success": true
},
"standardResult": {
"totals": [
18,
83,
80,
34
],
"instances": [
{
"ruleID": "QW-ACT-R63",
"what": "This rule checks that each page has an element with a landmark semantic role starting with non-repeated content",
"ordinalSeverity": 1,
"tagName": "HTML",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html"
},
"excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>"
},
{
"ruleID": "QW-ACT-R64",
"what": "This rule checks that the non-repeated content contains a heading",
"ordinalSeverity": 1,
"tagName": "HTML",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html"
},
"excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>"
},
{
"ruleID": "QW-ACT-R73",
"what": "This rule checks that repeated blocks of content are collapsible.",
"ordinalSeverity": 1,
"tagName": "HTML",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html"
},
"excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>"
},
{
"ruleID": "QW-ACT-R74",
"what": "This rule checks that there is an instrument to move focus to non-repeated content in the page.",
"ordinalSeverity": 1,
"tagName": "HTML",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html"
},
"excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body></body></html>"
},
{
"ruleID": "QW-ACT-R12",
"what": "This rule checks that each link has an accessible name.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>"
},
{
"ruleID": "QW-ACT-R12",
"what": "This rule checks that each link has an accessible name.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>"
},
{
"ruleID": "QW-ACT-R12",
"what": "This rule checks that each link has an accessible name.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>"
},
{
"ruleID": "QW-ACT-R18",
"what": "This rule checks that all id attribute values on a single page are unique.",
"ordinalSeverity": 3,
"tagName": "SCRIPT",
"id": "www-widgetapi-script",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > script:nth-child(25)"
},
"excerpt": "<script type=\"text/javascript\" id=\"www-widgetapi-script\" src=\"https://www.youtube.com/s/player/6ed0d907/www-widgetapi.vflset/www-widgetapi.js\" async=\"\"></script>"
},
{
"ruleID": "QW-ACT-R18",
"what": "This rule checks that all id attribute values on a single page are unique.",
"ordinalSeverity": 3,
"tagName": "SCRIPT",
"id": "www-widgetapi-script",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > script:nth-child(27)"
},
"excerpt": "<script type=\"text/javascript\" id=\"www-widgetapi-script\" src=\"https://www.youtube.com/s/player/6ed0d907/www-widgetapi.vflset/www-widgetapi.js\" async=\"\"></script>"
},
{
"ruleID": "QW-ACT-R18",
"what": "This rule checks that all id attribute values on a single page are unique.",
"ordinalSeverity": 3,
"tagName": "G",
"id": "close-popup",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1)"
},
"excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\"> </g>"
},
{
"ruleID": "QW-ACT-R18",
"what": "This rule checks that all id attribute values on a single page are unique.",
"ordinalSeverity": 3,
"tagName": "G",
"id": "close-popup",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1)"
},
"excerpt": "<g id=\"close-popup\" stroke=\"none\" stroke-width=\"1\" fill=\"none\" fill-rule=\"evenodd\" stroke-linecap=\"square\"> </g>"
},
{
"ruleID": "QW-ACT-R18",
"what": "This rule checks that all id attribute values on a single page are unique.",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(1)"
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
},
{
"ruleID": "QW-ACT-R18",
"what": "This rule checks that all id attribute values on a single page are unique.",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(2)"
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
},
{
"ruleID": "QW-ACT-R18",
"what": "This rule checks that all id attribute values on a single page are unique.",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(1)"
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\"></path>"
},
{
"ruleID": "QW-ACT-R18",
"what": "This rule checks that all id attribute values on a single page are unique.",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1) > g:nth-child(1) > path:nth-child(2)"
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">Home</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">Meet Joe</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">News</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">AD5</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">Issues</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">DONATE</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">$5</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">$10</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">$25</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">$50</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">$75</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">OTHER</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
},
"excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s ... [0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email *\" data-placeholder=\"Email *\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1)"
},
"excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj\" data-custom-id=\"nxouluvbretczsumlwfttgzfltqnntvlwvaf\">SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()} ... ggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this.start=t);var n=t-thi …"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\">Learn More</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
},
"excerpt": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@ ... \\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email*\" data-placeholder=\"Email*\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > button:nth-child(1)"
},
"excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-dyvgx\" data-custom-id=\"pctxnochcdlwubleyhhicvdleifnqiyrttuh\">Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.sta ... AnimationFrame(t.triggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this. …"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-16 current_page_item\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\">Home</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/about/\" data-brz-link-type=\"external\" id=\"\">Meet Joe</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/news/\" data-brz-link-type=\"external\" id=\"\">News</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\">AD5</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/issues/\" data-brz-link-type=\"external\" id=\"\">Issues</a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
},
"excerpt": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\ ... [0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email Updates\" data-placeholder=\"Email Updates\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1)"
},
"excerpt": "<button class=\"brz-btn brz-btn-submit brz-css-ystbj brz-css-rplcf\" data-custom-id=\"urngpgulgkggkfoivjalbjunpabjeeujtqmh\">SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=nul ... ionFrame(t.triggerAnimation.bind(t))},t.prototype.reset=function(){var t=this;window.cancelAnimationFrame(t.animationId)},t.prototype.triggerAnimation=function(t){var i=this;this.start||(this.start= …"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>"
},
{
"ruleID": "QW-ACT-R62",
"what": "This rule checks that each element in sequential focus order has some visible focus indication.",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"></a>"
},
{
"ruleID": "QW-ACT-R41",
"what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubydsxnh\" placeholder=\"First Name*\" required=\"\" data-type=\"Text\" data-label=\"First Name*\" data-placeholder=\"First Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R41",
"what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlommuh\" placeholder=\"Last Name*\" required=\"\" data-type=\"Text\" data-label=\"Last Name*\" data-placeholder=\"Last Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R41",
"what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
},
"excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsivdhir\" placeholder=\"Email *\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s ... [0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email *\" data-placeholder=\"Email *\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
},
{
"ruleID": "QW-ACT-R41",
"what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafnsjbg\" placeholder=\"Cell Phone\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone\" data-placeholder=\"Cell Phone\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R41",
"what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbqejd\" placeholder=\"Zip\" required=\"\" data-type=\"Text\" data-label=\"Zip\" data-placeholder=\"Zip\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R41",
"what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdhnmx\" placeholder=\"Name*\" required=\"\" data-type=\"Text\" data-label=\"Name*\" data-placeholder=\"Name*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R41",
"what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvlyfk\" placeholder=\"Title*\" required=\"\" data-type=\"Text\" data-label=\"Title*\" data-placeholder=\"Title*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R41",
"what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3) > input:nth-child(1)"
},
"excerpt": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpiuman\" placeholder=\"Email*\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\.,;:\\s@ ... \\.[0-9]{1,3}\\.[0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email*\" data-placeholder=\"Email*\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
},
{
"ruleID": "QW-ACT-R41",
"what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4) > input:nth-child(1)"
},
"excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwpqao\" placeholder=\"Cell Phone*\" required=\"\" data-type=\"Text\" data-label=\"Cell Phone*\" data-placeholder=\"Cell Phone*\" class=\"brz-input brz-forms2__field brz-forms2__field-text\">"
},
{
"ruleID": "QW-ACT-R41",
"what": "This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error.",
"ordinalSeverity": 1,
"tagName": "INPUT",
"id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1) > input:nth-child(1)"
},
"excerpt": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybxfcbc\" placeholder=\"Email Updates\" required=\"\" pattern=\"^(([^<>()\\[\\]\\\\.,;:\\s@"]+(\\.[^<>()\\[\\]\\\\ ... [0-9]{1,3}\\.[0-9]{1,3}])|(([a-zA-Z\\-0-9]+\\.)+[a-zA-Z]{2,}))$\" data-type=\"Email\" data-label=\"Email Updates\" data-placeholder=\"Email Updates\" class=\"brz-input brz-forms2__field brz-forms2__field-email\">"
},
{
"ruleID": "QW-ACT-R17",
"what": "This rule checks that each image that is not marked as decorative, has an accessible name.",
"ordinalSeverity": 3,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > img:nth-child(1)"
},
"excerpt": "<img src=\"http://ib.adnxs.com/seg?add=30067132&t=2\" width=\"1\" height=\"1\">"
},
{
"ruleID": "QW-ACT-R37",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Home</span>"
},
{
"ruleID": "QW-ACT-R37",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Meet Joe</span>"
},
{
"ruleID": "QW-ACT-R37",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">News</span>"
},
{
"ruleID": "QW-ACT-R37",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">AD5</span>"
},
{
"ruleID": "QW-ACT-R37",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Issues</span>"
},
{
"ruleID": "QW-ACT-R37",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Home</span>"
},
{
"ruleID": "QW-ACT-R37",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Meet Joe</span>"
},
{
"ruleID": "QW-ACT-R37",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">News</span>"
},
{
"ruleID": "QW-ACT-R37",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">AD5</span>"
},
{
"ruleID": "QW-ACT-R37",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Issues</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Home</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Meet Joe</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">News</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">AD5</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Issues</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Home</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Meet Joe</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">News</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">AD5</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Issues</span>"
},
{
"ruleID": "QW-ACT-R76",
"what": "This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>"
},
{
"ruleID": "QW-ACT-R75",
"what": "This rule checks that each page has a mechanism to bypass repeated blocks of content.",
"ordinalSeverity": 1,
"tagName": "HTML",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html"
},
"excerpt": "<html dir=\"ltr\" lang=\"en-US\" prefix=\"og: https://ogp.me/ns#\"><head></head><body>Joe Patterson {\"@context\":\"https:\\/\\/schema.org\",\"@graph\":[{\"@type\":\"WebSite\",\"@id\":\"https:\\/\\/joepatterson.com\\/#websit ... e\":\"https:\\/\\/joepatterson.com\\/?s={search_term_string}\"},\"query-input\":\"required name=search_term_string\"}},{\"@type\":\"Organization\",\"@id\":\"https:\\/\\/joepatterson.com\\/#organization\",\"name\":\"Joe Pat …"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Home</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Meet Joe</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">News</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">AD5</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Issues</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(2)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">DONATE</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color3\">THANK YOU!</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color3\">-Joe Patterson </span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
},
"excerpt": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color8\">STAND WITH JOE:</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">$5</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">$10</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">$25</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">$50</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">$75</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">OTHER</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(6) > button:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color1\">Meet Joe Patterson</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four c ... n. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">Learn More</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
},
"excerpt": "<strong class=\"brz-cp-color8\">Endorse Joe</strong>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5) > button:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">Endorse Joe!</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Home</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Meet Joe</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(3) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">News</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(4) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">AD5</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(5) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span\">Issues</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2) > button:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-text__editor\">SUBMIT</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color8\">Paid for by Joe Patterson for Assembly 2024 FPPC ID</span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(2)"
},
"excerpt": "<span class=\"brz-cp-color8 brz-pre-population-visible\"># </span>"
},
{
"ruleID": "QW-ACT-R40",
"what": "This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport.",
"ordinalSeverity": 1,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(3)"
},
"excerpt": "<span class=\"brz-cp-color8\">1456524</span>"
},
{
"ruleID": "QW-WCAG-T23",
"what": "The objective of this technique is to provide a mechanism to bypass blocks of material that are repeated on multiple Web pages by skipping directly to the main content of the Web page.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>"
},
{
"ruleID": "QW-WCAG-T21",
"what": "This technique checks the text alternative of images which are the only content of a link",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"></a>"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(2)"
},
"excerpt": "<link rel=\"profile\" href=\"http://gmpg.org/xfn/11\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(3)"
},
"excerpt": "<link rel=\"pingback\" href=\"https://joepatterson.com/xmlrpc.php\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(31)"
},
"excerpt": "<link rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "astra-theme-css-css",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(36)"
},
"excerpt": "<link rel=\"stylesheet\" id=\"astra-theme-css-css\" href=\"https://joepatterson.com/wp-content/themes/astra/assets/css/minified/main.min.css?ver=3.7.10\" media=\"all\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "wp-block-library-css",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(38)"
},
"excerpt": "<link rel=\"stylesheet\" id=\"wp-block-library-css\" href=\"https://joepatterson.com/wp-includes/css/dist/block-library/style.min.css?ver=6.2.2\" media=\"all\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "brizy-asset-google-10-css",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(40)"
},
"excerpt": "<link rel=\"stylesheet\" id=\"brizy-asset-google-10-css\" class=\"brz-link brz-link-google\" type=\"text/css\" href=\"https://fonts.googleapis.com/css?family=Overpass%3A100%2C100italic%2C200%2C200italic%2C300% ... c%2C300%2C300italic%2Cregular%2Citalic%2C700%2C700italic%2C900%2C900italic%7CRed+Hat+Text%3Aregular%2Citalic%2C500%2C500italic%2C700%2C700italic&subset=arabic%2Cbengali%2Ccyrillic%2Ccyrillic-ext …"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "brizy-asset-group-1-20-css",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(41)"
},
"excerpt": "<link rel=\"stylesheet\" id=\"brizy-asset-group-1-20-css\" class=\"brz-link brz-link-preview-lib\" data-group=\"group-1\" href=\"https://joepatterson.com/wp-content/plugins/brizy/public/editor-build/232-wp/editor/css/group-1.css?ver=2.3.35\" media=\"all\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "brizy-asset-group-2-21-css",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(42)"
},
"excerpt": "<link rel=\"stylesheet\" id=\"brizy-asset-group-2-21-css\" class=\"brz-link brz-link-preview-lib-pro\" data-group=\"group-2\" href=\"https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/group-2-pro.css?ver=2.3.28\" media=\"all\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "brizy-asset-main-30-css",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(43)"
},
"excerpt": "<link rel=\"stylesheet\" id=\"brizy-asset-main-30-css\" class=\"brz-link brz-link-preview-pro\" href=\"https://joepatterson.com/wp-content/plugins/brizy-pro/public/editor-build/107-wp/css/preview.pro.css?ver=2.3.28\" media=\"all\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(48)"
},
"excerpt": "<link rel=\"https://api.w.org/\" href=\"https://joepatterson.com/wp-json/\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(50)"
},
"excerpt": "<link rel=\"EditURI\" type=\"application/rsd+xml\" title=\"RSD\" href=\"https://joepatterson.com/xmlrpc.php?rsd\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(51)"
},
"excerpt": "<link rel=\"wlwmanifest\" type=\"application/wlwmanifest+xml\" href=\"https://joepatterson.com/wp-includes/wlwmanifest.xml\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > head:nth-child(1) > link:nth-child(53)"
},
"excerpt": "<link rel=\"shortlink\" href=\"https://joepatterson.com/\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"ordinalSeverity": 0,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > link:nth-child(7)"
},
"excerpt": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//ajax.googleapis.com\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"ordinalSeverity": 0,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > link:nth-child(8)"
},
"excerpt": "<link class=\"brz-link brz-link-google-prefetch\" rel=\"dns-prefetch\" href=\"//fonts.googleapis.com\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"ordinalSeverity": 0,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > link:nth-child(9)"
},
"excerpt": "<link class=\"brz-link brz-link-google-preconnect\" rel=\"preconnect\" href=\"https://fonts.gstatic.com/\" crossorigin=\"\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"ordinalSeverity": 0,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > link:nth-child(12)"
},
"excerpt": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-32x32.jpg\" sizes=\"32x32\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"ordinalSeverity": 0,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > link:nth-child(13)"
},
"excerpt": "<link rel=\"icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-192x192.jpg\" sizes=\"192x192\">"
},
{
"ruleID": "QW-WCAG-T15",
"what": "The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages.",
"ordinalSeverity": 0,
"tagName": "LINK",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > link:nth-child(14)"
},
"excerpt": "<link rel=\"apple-touch-icon\" href=\"https://joepatterson.com/wp-content/uploads/2022/01/cropped-PattersonIcon-180x180.jpg\">"
},
{
"ruleID": "QW-WCAG-T32",
"what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2)"
},
"excerpt": "<ul class=\"brz-menu__ul brz-mm-listview\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-mm-menu__item brz-mm-menu__item-empty brz-mm-menu__item--current brz-mm-listitem\" data ... l > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(1) > a:nth-child(1)\" _cssrules=\"true\"><span class=\"brz-span\" _sele …"
},
{
"ruleID": "QW-WCAG-T32",
"what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > div:nth-child(3) > ul:nth-child(1)"
},
"excerpt": "<ul class=\"brz-mm-menu__sub-menu brz-menu__ul--has-dropdown brz-mm-listview\"><li class=\"brz-mm-menu__item brz-mm-menu__item-empty brz-mm-listitem\" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"> ... -child(2) > li:nth-child(2) > div:nth-child(3) > ul:nth-child(1) > li:nth-child(1) > a:nth-child(1)\" _cssrules=\"true\"><span class=\"brz-span\" _selector=\"html > body:nth-child(2) > div:nth-child(24) > …"
},
{
"ruleID": "QW-WCAG-T32",
"what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1)"
},
"excerpt": "<ul class=\"brz-menu__ul\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-menu__item brz-menu__item--current\" data-menu-item-id=\"b80377d0ea164df79e92847fe9d7db93\"><a class=\"brz ... div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-c …"
},
{
"ruleID": "QW-WCAG-T32",
"what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > ul:nth-child(2)"
},
"excerpt": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22% ... \" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"e …"
},
{
"ruleID": "QW-WCAG-T32",
"what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1)"
},
"excerpt": "<ul class=\"brz-menu__ul\" data-menu-items-active=\"b80377d0ea164df79e92847fe9d7db93\"><li class=\"brz-menu__item brz-menu__item--current\" data-menu-item-id=\"b80377d0ea164df79e92847fe9d7db93\"><a class=\"brz ... iv:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(1) > a:nth-child …"
},
{
"ruleID": "QW-WCAG-T32",
"what": "The objective of this technique is to create lists of related items using list elements appropriate for their purposes.",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > nav:nth-child(1) > ul:nth-child(1) > li:nth-child(2) > ul:nth-child(2)"
},
"excerpt": "<ul data-settings=\"%7B%22mods%22%3A%7B%22desktop%22%3A%22horizontal%22%2C%22tablet%22%3A%22horizontal%22%2C%22mobile%22%3A%22horizontal%22%7D%2C%22placement%22%3A%7B%22desktop%22%3A%22bottom-start%22% ... opper-placement=\"top-start\"><li class=\"brz-menu__item\" data-menu-item-id=\"40f9161af83cb11a2624190f2c55b06d\"><a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://jo …"
},
{
"ruleID": "QW-WCAG-T19",
"what": "The objective of this technique is to provide a mechanism that allows users to explicitly request changes of context. The intended use of a submit button is to generate an HTTP request that submits data entered in a form, so it is an appropriate control to use for causing a change of context.",
"ordinalSeverity": 2,
"tagName": "FORM",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
},
"excerpt": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"dskyguesfdwsuhockwwasaportijqvjngws ... e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationF …"
},
{
"ruleID": "QW-WCAG-T19",
"what": "The objective of this technique is to provide a mechanism that allows users to explicitly request changes of context. The intended use of a submit button is to generate an HTTP request that submits data entered in a form, so it is an appropriate control to use for causing a change of context.",
"ordinalSeverity": 2,
"tagName": "FORM",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
},
"excerpt": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"fbtlofiblnoutrunfzizbsdvloekmnvpisx ... ationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype …"
},
{
"ruleID": "QW-WCAG-T19",
"what": "The objective of this technique is to provide a mechanism that allows users to explicitly request changes of context. The intended use of a submit button is to generate an HTTP request that submits data entered in a form, so it is an appropriate control to use for causing a change of context.",
"ordinalSeverity": 2,
"tagName": "FORM",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1)"
},
"excerpt": "<form class=\"brz-form brz-d-xs-flex brz-flex-xs-wrap\" action=\"https://joepatterson.com/wp-admin/admin-ajax.php?action=brizy_submit_form\" novalidate=\"\" data-form-id=\"fonhcxfbmwbbacpwvgmiprkqrpdqrdbvdnr ... getTime();i||(i=e);var a=Math.max(0,16-(e-i)),o=window.setTimeout(function(){t(e+a)},a);return i=e+a,o}}t.prototype.init=function(){var t=this;this.animationId=window.requestAnimationFrame(t.trigger …"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-icon css-3z2g66\"> </span>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-pzxzi\" data-uniq-id=\"ktmas\" data-generated-css=\"brz-css-xvlfv\"></p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1)"
},
"excerpt": "<svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\"> </svg>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-zctmh\" data-uniq-id=\"hlkbv\" data-generated-css=\"brz-css-yeiqu\">HOME</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\">DONATE</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > svg:nth-child(1)"
},
"excerpt": "<svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0px\" y=\"0px\" viewBox=\"0 0 24 24\" xml:space=\"preserve\" class=\"brz-icon-svg brz-css-oheuj\" data-type=\"glyph\" data-name=\"tail-right\"></svg>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-icon css-1v9psv1\"></span>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-mntwc\" data-uniq-id=\"acvfi\" data-generated-css=\"brz-css-iqboz\">THANK YOU!</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-vtphm\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"> </p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2)"
},
"excerpt": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3)"
},
"excerpt": "<p class=\"brz-css-swhqo\" data-generated-css=\"brz-css-kojbz\" data-uniq-id=\"rjmkq\">-Joe Patterson </p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-icon css-1cnr1ql\"></span>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-lkuyo\" data-generated-css=\"brz-css-kokqw\" data-uniq-id=\"hpxfi\">JOE PATTERSON</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-mkkan\" data-uniq-id=\"lwuac\" data-generated-css=\"brz-css-erjeq\">Your voice in the State Assembly.</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdggtybzbtscl\">$5</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufznyxypipympv\">$10</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurwjvjsywyumae\">$25</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(4) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-cbllz\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yemcvnewgngfymiotxewwyjzajhaeldnceah\">OTHER</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p data-uniq-id=\"qctya\" data-generated-css=\"brz-css-oooyn\" class=\"brz-css-yhukw\">STAND WITH JOE:</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauwevuzk\">$5</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmnsxqzeqs\">$10</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimuehzaucij\">$25</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabzsrnrpgdxssd\">$50</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzytxqskff\">$75</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\">OTHER</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p data-uniq-id=\"hwwdz\" data-generated-css=\"brz-css-owosm\" class=\"brz-css-dbkfe\">JOIN THE TEAM</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-gjenq\"></div>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-sqjjw\"></div>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk\"></div>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-solsx\"></div>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(5)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-pmcfe brz-css-liimk brz-css-xnabq\"></div>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-nhelt\" data-generated-css=\"brz-css-fyurj\" data-uniq-id=\"ssqmz\">Meet Joe Patterson</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four c ... n. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\">Learn More</a>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-bklfk\" data-uniq-id=\"qxpfh\" data-generated-css=\"brz-css-owucl\">Endorse Joe</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-ilwyl\"></div>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(2)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-odtpn\"></div>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(3)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-fyenv\"></div>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(4)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-kcqoq brz-css-liimk brz-css-cbrxq\"></div>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > form:nth-child(1) > div:nth-child(1)"
},
"excerpt": "<div class=\"brz-forms2__item brz-css-umcxw brz-css-ztibp brz-css-liimk brz-css-vgqwm\"></div>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-icon css-1yqt0eo\"></span>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-span brz-icon css-1ldonqd\"></span>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "SVG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > svg:nth-child(1)"
},
"excerpt": "<svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\"> </svg>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-rjztm\" data-uniq-id=\"hlkbv\" data-generated-css=\"brz-css-yeiqu\">HOME</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-xquao\" data-generated-css=\"brz-css-mqzvf\" data-uniq-id=\"fmuwc\">MEET JOE</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-yjyph\" data-uniq-id=\"lejsp\" data-generated-css=\"brz-css-fumnn\">NEWS</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-bwxye\" data-generated-css=\"brz-css-tujgm\" data-uniq-id=\"ulmaa\">AD5</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-wwpav\" data-uniq-id=\"qtxdk\" data-generated-css=\"brz-css-hhgpv\">ENDORSEMENTS</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-tbnau\" data-uniq-id=\"knloz\" data-generated-css=\"brz-css-opatl\">YARD SIGNS</p>"
},
{
"ruleID": "QW-WCAG-T28",
"what": "This technique checks that all font-size attribute uses percent, em or names.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(7) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-dzpeg\" data-generated-css=\"brz-css-nsqiu\" data-uniq-id=\"dmvlt\">VOLUNTEER</p>"
},
{
"ruleID": "QW-WCAG-T29",
"what": "This technique describes how to align blocks of text either left or right by setting the CSS text-align property.",
"ordinalSeverity": 2,
"tagName": "STYLE",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > style:nth-child(11)"
},
"excerpt": "<style class=\"brz-style\">@media(min-width:991px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:991px) and (min-width:768px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:767px){.brz .brz ... \";background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-color{background-color:rgba(0, 0, 0, 0);background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-shape__top{background-size: 10 …"
},
{
"ruleID": "QW-WCAG-T29",
"what": "This technique describes how to align blocks of text either left or right by setting the CSS text-align property.",
"ordinalSeverity": 2,
"tagName": "STYLE",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > style:nth-child(11)"
},
"excerpt": "<style class=\"brz-style\">@media(min-width:991px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:991px) and (min-width:768px){.brz .brz-css-nkwmc{display:block;}}@media(max-width:767px){.brz .brz ... \";background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-color{background-color:rgba(0, 0, 0, 0);background-image:none;}.brz .brz-css-mmmvq > .brz-bg > .brz-bg-shape__top{background-size: 10 …"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "NOSCRIPT",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > noscript:nth-child(5)"
},
"excerpt": "<noscript> <img height=\"1\" width=\"1\" style=\"display:none\" alt=\"fbpx\" src=\"https://www.facebook.com/tr?id=1411298592623596&ev=PageView&noscript=1\" /> </noscript>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a href=\"https://joepatterson.com/\" style=\"\" class=\"link--external is-empty brz-cp-color8\" data-brz-link-type=\"external\">HOME</a>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color3\">THANK YOU!</span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(2) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(3) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color3\">-Joe Patterson </span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
},
"excerpt": "<strong class=\"brz-scp-color2\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px; color: rgb(255, 255, 255);\">JOE PATTERSON</strong>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(3) > div:nth-child(1) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-scp-color2 brz-cp-color8\" style=\"text-shadow: rgb(28, 28, 28) 5px 5px 5px;\">Your voice in the State Assembly.</span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(5) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color8\">STAND WITH JOE:</span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(6) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color8\">JOIN THE TEAM</span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color1\">Meet Joe Patterson</span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(7) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1)"
},
"excerpt": "<p class=\"brz-css-bnogt\" data-uniq-id=\"mdupv\" data-generated-css=\"brz-css-eyoug\">Joe Patterson and his wife Colleen understand the challenges facing today’s families as they work to raise their four c ... n. That’s what propelled Joe to get involved in public service and eventually run for the City Council. Joe’s top priority is to make our community a better place to live, work and raise a family.</p>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > section:nth-child(8) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > strong:nth-child(1)"
},
"excerpt": "<strong class=\"brz-cp-color8\">Endorse Joe</strong>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-cp-color8\">Paid for by Joe Patterson for Assembly 2024 FPPC ID</span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(2)"
},
"excerpt": "<span class=\"brz-cp-color8 brz-pre-population-visible\"># </span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > footer:nth-child(9) > div:nth-child(2) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > span:nth-child(3)"
},
"excerpt": "<span class=\"brz-cp-color8\">1456524</span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > div:nth-child(10) > a:nth-child(1) > span:nth-child(1)"
},
"excerpt": "<span class=\"brz-mm-sronly\">Close menu</span>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a href=\"https://joepatterson.com/\" style=\"\" class=\"link--external is-empty brz-cp-color8\" data-brz-link-type=\"external\">HOME</a>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a href=\"/about/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">MEET JOE</a>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(3) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a href=\"/news/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">NEWS</a>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(4) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a href=\"/ad5/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">AD5</a>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(5) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a href=\"/endorsements/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">ENDORSEMENTS</a>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(6) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a href=\"/yard-sign/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">YARD SIGNS</a>"
},
{
"ruleID": "QW-WCAG-T31",
"what": "Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination.",
"ordinalSeverity": 2,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(25) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(2) > div:nth-child(1) > div:nth-child(1) > div:nth-child(7) > div:nth-child(1) > div:nth-child(1) > p:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a href=\"/yard-sign/\" style=\"\" class=\"link--external brz-cp-color8\" data-brz-link-type=\"external\">VOLUNTEER</a>"
},
{
"ruleID": "QW-BP17",
"what": "The objective of this technique is to provide a mechanism to bypass a block of material by skipping to the end of the block.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > div:nth-child(1) > a:nth-child(1)"
},
"excerpt": "<a class=\"brz-mm-navbar__title\" href=\"#mm-1\">Main Menu</a>"
},
{
"ruleID": "QW-BP17",
"what": "The objective of this technique is to provide a mechanism to bypass a block of material by skipping to the end of the block.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "mm-1",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1)"
},
"excerpt": "<div id=\"mm-1\" class=\"brz-mm-panel brz-mm-panel_opened\">Main MenuHomeMeet JoeToggle submenuTVNewsAD5Issues</div>"
},
{
"ruleID": "QW-BP17",
"what": "The objective of this technique is to provide a mechanism to bypass a block of material by skipping to the end of the block.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > a:nth-child(2)"
},
"excerpt": "<a class=\"brz-mm-btn brz-mm-btn_next brz-mm-listitem__btn\" href=\"#mm-2\">Toggle submenu</a>"
},
{
"ruleID": "QW-BP17",
"what": "The objective of this technique is to provide a mechanism to bypass a block of material by skipping to the end of the block.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "mm-2",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > nav:nth-child(1) > div:nth-child(1) > div:nth-child(1) > ul:nth-child(2) > li:nth-child(2) > div:nth-child(3)"
},
"excerpt": "<div id=\"mm-2\" class=\"brz-mm-panel brz-mm-hidden\" aria-hidden=\"true\">TV</div>"
},
{
"ruleID": "QW-BP17",
"what": "The objective of this technique is to provide a mechanism to bypass a block of material by skipping to the end of the block.",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24) > div:nth-child(10) > a:nth-child(1)"
},
"excerpt": "<a href=\"#mm-0\">Close menu</a>"
},
{
"ruleID": "QW-BP17",
"what": "The objective of this technique is to provide a mechanism to bypass a block of material by skipping to the end of the block.",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "mm-0",
"location": {
"doc": "dom",
"type": "selector",
"spec": "html > body:nth-child(2) > div:nth-child(24)"
},
"excerpt": "<div class=\"brz-root__container brz-reset-all brz-mm-page brz-mm-slideout\" id=\"mm-0\">Main MenuHomeMeet JoeToggle submenuTVNewsAD5IssuesHomeMeet JoeTVNewsAD5Issues HOMEDONATETHANK YOU! Thank you for ch ... t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!window.requestAnimationFrame){var i=null;window.requestAnimationFrame=function(t,n){var e=(new Date).getTime();i||(i=e);var a=Mat …"
}
]
},
"endTime": 1687099530187
},
{
"type": "test",
"which": "tenon",
"id": "a",
"startTime": 1687099530187,
"url": "https://joepatterson.com/",
"what": "Tenon",
"result": {
"status": 200,
"message": "OK",
"code": "success",
"info": "Success",
"moreInfo": "https://tenon.io/documentation/apiv2/response-codes#success",
"responseExecTime": "0.078",
"responseTime": "2023-06-18T14:45:29.759Z",
"data": {
"apiErrors": [],
"documentSize": 1251305,
"metadata": null,
"resultSummary": {
"tests": {
"total": 180,
"passing": 169,
"failing": 11
},
"issues": {
"totalErrors": 50,
"totalWarnings": 13,
"totalIssues": 63
},
"issuesByLevel": {
"A": {
"count": 45,
"pct": 71.43
},
"AA": {
"count": 35,
"pct": 55.56
},
"AAA": {
"count": 63,
"pct": 100
}
},
"density": {
"errorDensity": 4,
"warningDensity": 1,
"allDensity": 5
}
},
"projectID": "E4B12DC9-2F67-8DB7-26C9-E50C8490",
"responseID": "ee11ce3e-8e45-41a2-8855-dd0e3265733d",
"docID": "a3a50fdb-6f26-4cb5-cb4a-7f78b05c92be",
"sourceHash": "f67d78ad6922bd6362e0415c27b0cb17",
"urlHttpCode": 200,
"clientScriptErrors": [
{},
{},
{},
{},
{}
],
"remainingApiCalls": {
"planCalls": 0,
"boosts": 19
},
"globalStats": {
"errorDensity": "N/A",
"warningDensity": "N/A",
"allDensity": "N/A",
"stdDev": "N/A"
},
"resultUrl": "http://ngnix/history.php?responseID=ee11ce3e-8e45-41a2-8855-dd0e3265733d",
"resultSet": [
{
"tID": 28,
"bpID": 3,
"priority": 100,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "The layout or sizing of this page causes horizontal scrolling.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 1.4.8 Visual Presentation"
],
"resultTitle": "Avoid layouts that result in horizontal scroll",
"errorDescription": "This page is too wide, causing horizontal scrolling (at the tested viewport size). Horizontal scrolling will cause difficulties for users with low vision, especially if they have their monitor set to a low resolution. Review HTML, CSS and page element sizes to ensure 100% width is not exceeded.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 1024,
"y": 3340.09
},
"height": 3340.09,
"width": 1024
},
"position": {
"line": 4738,
"column": 60
},
"errorSnippet": "<body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar as",
"xpath": "/html/body",
"issueID": "770f99bcff51e27946efb6b3e8938796",
"signature": "5467cc8c0d13a168b59028a81d7c9082",
"ref": "https://tenon.io/bestpractice.php?bpID=3&tID=28&issueID=770f99bcff51e27946efb6b3e8938796"
},
{
"tID": 36,
"bpID": 4,
"priority": 100,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This text is justified.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 1.4.8 Visual Presentation"
],
"resultTitle": "Avoid using justified text",
"errorDescription": "This text has been styled with CSS to display as justified. Justified text causes readability problems for people with learning disabilities, dyslexia and some visual disabilities. Long passages of fully justified text creates inconsistent spacing between word and letter boundaries that can make reading justified text very difficult. Ensure that text is not styled to be fully justified (aligned to both the left and the right margins).",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 39
},
"bottom-right": {
"x": 849.547,
"y": 156
},
"height": 117,
"width": 849.547
},
"position": {
"line": 10644,
"column": 0
},
"errorSnippet": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"><span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th Distr",
"xpath": "/html/body/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]",
"issueID": "b2edca6df6e6651c6ae7e3450b7e4bda",
"signature": "87e608cf86a8b2d896573fb23c606819",
"ref": "https://tenon.io/bestpractice.php?bpID=4&tID=36&issueID=b2edca6df6e6651c6ae7e3450b7e4bda"
},
{
"tID": 36,
"bpID": 4,
"priority": 100,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This text is justified.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 1.4.8 Visual Presentation"
],
"resultTitle": "Avoid using justified text",
"errorDescription": "This text has been styled with CSS to display as justified. Justified text causes readability problems for people with learning disabilities, dyslexia and some visual disabilities. Long passages of fully justified text creates inconsistent spacing between word and letter boundaries that can make reading justified text very difficult. Ensure that text is not styled to be fully justified (aligned to both the left and the right margins).",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 40
},
"bottom-right": {
"x": 855,
"y": 154
},
"height": 114,
"width": 855
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>",
"xpath": "/html/body/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]",
"issueID": "910315bf697e44853b71434e4bcd4abd",
"signature": "ed62e919decf36f6f095ba8b5e48e535",
"ref": "https://tenon.io/bestpractice.php?bpID=4&tID=36&issueID=910315bf697e44853b71434e4bcd4abd"
},
{
"tID": 57,
"bpID": 106,
"priority": 100,
"level": [
"A",
"AAA"
],
"certainty": 100,
"errorTitle": "This link has no text inside it.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 2.4.4 Link Purpose (In Context)",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.4.9 Link Purpose (Link Only)"
],
"resultTitle": "Make sure that link text (and the alternate text for any images that are used as links) describes the destination or purpose of the link.",
"errorDescription": "The text inside of a link informs the user of the purpose or destination of the link. Because this link has no text, users will not know what the link does or where it takes them when they activate the link. This poses problems for users of screenreaders and voice dictation. Add text within this link to make it usable and understandable for all users",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 294.734,
"y": 112.969
},
"height": 112.969,
"width": 294.734
},
"position": {
"line": 2703,
"column": 0
},
"errorSnippet": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"><picture class=\"brz-picture brz-d-block brz-p-relative brz-css-ptqop\"><img decoding=\"async\" class=\"",
"xpath": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"issueID": "503b58e0e614196f40f9c5eba92e3e27",
"signature": "586c70b6c825ff330c5a69198e0880ca",
"ref": "https://tenon.io/bestpractice.php?bpID=106&tID=57&issueID=503b58e0e614196f40f9c5eba92e3e27"
},
{
"tID": 57,
"bpID": 106,
"priority": 100,
"level": [
"A",
"AAA"
],
"certainty": 100,
"errorTitle": "This link has no text inside it.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 2.4.4 Link Purpose (In Context)",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.4.9 Link Purpose (Link Only)"
],
"resultTitle": "Make sure that link text (and the alternate text for any images that are used as links) describes the destination or purpose of the link.",
"errorDescription": "The text inside of a link informs the user of the purpose or destination of the link. Because this link has no text, users will not know what the link does or where it takes them when they activate the link. This poses problems for users of screenreaders and voice dictation. Add text within this link to make it usable and understandable for all users",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 0,
"y": 0
},
"height": 0,
"width": 0
},
"position": {
"line": 2733,
"column": 1090
},
"errorSnippet": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\"><span class=\"brz-span brz-icon css-3z2g66\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0",
"xpath": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]",
"issueID": "bf4bc89c19a7df68c1489b52eb4f3fcd",
"signature": "554bdad800a8780be3697d3ec5263808",
"ref": "https://tenon.io/bestpractice.php?bpID=106&tID=57&issueID=bf4bc89c19a7df68c1489b52eb4f3fcd"
},
{
"tID": 57,
"bpID": 106,
"priority": 100,
"level": [
"A",
"AAA"
],
"certainty": 100,
"errorTitle": "This link has no text inside it.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 2.4.4 Link Purpose (In Context)",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.4.9 Link Purpose (Link Only)"
],
"resultTitle": "Make sure that link text (and the alternate text for any images that are used as links) describes the destination or purpose of the link.",
"errorDescription": "The text inside of a link informs the user of the purpose or destination of the link. Because this link has no text, users will not know what the link does or where it takes them when they activate the link. This poses problems for users of screenreaders and voice dictation. Add text within this link to make it usable and understandable for all users",
"viewPortLocation": {
"top-left": {
"x": 14,
"y": 6.234375
},
"bottom-right": {
"x": 46,
"y": 23.234375
},
"height": 17,
"width": 32
},
"position": {
"line": 6864,
"column": 0
},
"errorSnippet": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1yqt0eo\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmln",
"xpath": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"issueID": "2effa1e9ba55ef8e4a950f2b3bee493e",
"signature": "d487f31722d796ba9d00afd07517f0c7",
"ref": "https://tenon.io/bestpractice.php?bpID=106&tID=57&issueID=2effa1e9ba55ef8e4a950f2b3bee493e"
},
{
"tID": 57,
"bpID": 106,
"priority": 100,
"level": [
"A",
"AAA"
],
"certainty": 100,
"errorTitle": "This link has no text inside it.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 2.4.4 Link Purpose (In Context)",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.4.9 Link Purpose (Link Only)"
],
"resultTitle": "Make sure that link text (and the alternate text for any images that are used as links) describes the destination or purpose of the link.",
"errorDescription": "The text inside of a link informs the user of the purpose or destination of the link. Because this link has no text, users will not know what the link does or where it takes them when they activate the link. This poses problems for users of screenreaders and voice dictation. Add text within this link to make it usable and understandable for all users",
"viewPortLocation": {
"top-left": {
"x": 14,
"y": 6.234375
},
"bottom-right": {
"x": 46,
"y": 23.234375
},
"height": 17,
"width": 32
},
"position": {
"line": 6864,
"column": 0
},
"errorSnippet": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1ldonqd\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http:/",
"xpath": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
"issueID": "53003a60f909447706e94ec79fde72c8",
"signature": "af3be494b209c6688298dbcb662bba71",
"ref": "https://tenon.io/bestpractice.php?bpID=106&tID=57&issueID=53003a60f909447706e94ec79fde72c8"
},
{
"tID": 73,
"bpID": 106,
"priority": 100,
"level": [
"A",
"AAA"
],
"certainty": 100,
"errorTitle": "This link text is uninformative.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 2.4.4 Link Purpose (In Context)",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.4.9 Link Purpose (Link Only)"
],
"resultTitle": "Make sure that link text (and the alternate text for any images that are used as links) describes the destination or purpose of the link.",
"errorDescription": "The text in this link is too generic to be helpful for users. Users will be unable to discern the purpose or destination of the link without reading the text that surrounds it. Change the text in this link to something that is unique and informative so that the user can understand what content or actions can be found at the link's destination.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 140,
"y": 40
},
"height": 40,
"width": 135
},
"position": {
"line": 6695,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\"><span class=\"brz-span brz-text__editor\">Learn More</span></a>",
"xpath": "/html/body/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]",
"issueID": "da8f313b91dfb7957a288788c27f38b4",
"signature": "5a12c93ebbdb52f1d4f48c0cfc8a732f",
"ref": "https://tenon.io/bestpractice.php?bpID=106&tID=73&issueID=da8f313b91dfb7957a288788c27f38b4"
},
{
"tID": 98,
"bpID": 105,
"priority": 100,
"level": [
"A",
"AAA"
],
"certainty": 100,
"errorTitle": "These links have the same text but different destinations.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 2.4.4 Link Purpose (In Context)",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.4.9 Link Purpose (Link Only)"
],
"resultTitle": "Don't reuse the same link text for links that have different destinations",
"errorDescription": "This link has the same text as another link that goes to a different place. Using the same text for multiple links which point to different pages is ambiguous and may be confusing for assistive technology users, or for users who have a cognitive disability. Link text should tell the user where they will go if they follow the link. If two links on a page go to two different destinations, use different link text that accurately and concisely describes their destination.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 33,
"y": 38
},
"height": 38,
"width": 28
},
"position": {
"line": 6335,
"column": 34
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauw",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]",
"issueID": "0ed77f2cef19da9bc880ec1e4c2aa25d",
"signature": "6b92dd59bc6186b2c8ed5368f12b084e",
"ref": "https://tenon.io/bestpractice.php?bpID=105&tID=98&issueID=0ed77f2cef19da9bc880ec1e4c2aa25d"
},
{
"tID": 98,
"bpID": 105,
"priority": 100,
"level": [
"A",
"AAA"
],
"certainty": 100,
"errorTitle": "These links have the same text but different destinations.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 2.4.4 Link Purpose (In Context)",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.4.9 Link Purpose (Link Only)"
],
"resultTitle": "Don't reuse the same link text for links that have different destinations",
"errorDescription": "This link has the same text as another link that goes to a different place. Using the same text for multiple links which point to different pages is ambiguous and may be confusing for assistive technology users, or for users who have a cognitive disability. Link text should tell the user where they will go if they follow the link. If two links on a page go to two different destinations, use different link text that accurately and concisely describes their destination.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 45,
"y": 38
},
"height": 38,
"width": 40
},
"position": {
"line": 6336,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmns",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]",
"issueID": "fe18b086405d824be9b0b33cd161ba26",
"signature": "10077cf22567ec33a48d0733b3809aff",
"ref": "https://tenon.io/bestpractice.php?bpID=105&tID=98&issueID=fe18b086405d824be9b0b33cd161ba26"
},
{
"tID": 98,
"bpID": 105,
"priority": 100,
"level": [
"A",
"AAA"
],
"certainty": 100,
"errorTitle": "These links have the same text but different destinations.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 2.4.4 Link Purpose (In Context)",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.4.9 Link Purpose (Link Only)"
],
"resultTitle": "Don't reuse the same link text for links that have different destinations",
"errorDescription": "This link has the same text as another link that goes to a different place. Using the same text for multiple links which point to different pages is ambiguous and may be confusing for assistive technology users, or for users who have a cognitive disability. Link text should tell the user where they will go if they follow the link. If two links on a page go to two different destinations, use different link text that accurately and concisely describes their destination.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 47,
"y": 38
},
"height": 38,
"width": 42
},
"position": {
"line": 6336,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimueh",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]",
"issueID": "e494132db44edc0bf063abe91cb1879c",
"signature": "4138c7aee795190cf040f7bfda1a52b9",
"ref": "https://tenon.io/bestpractice.php?bpID=105&tID=98&issueID=e494132db44edc0bf063abe91cb1879c"
},
{
"tID": 98,
"bpID": 105,
"priority": 100,
"level": [
"A",
"AAA"
],
"certainty": 100,
"errorTitle": "These links have the same text but different destinations.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 2.4.4 Link Purpose (In Context)",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.4.9 Link Purpose (Link Only)"
],
"resultTitle": "Don't reuse the same link text for links that have different destinations",
"errorDescription": "This link has the same text as another link that goes to a different place. Using the same text for multiple links which point to different pages is ambiguous and may be confusing for assistive technology users, or for users who have a cognitive disability. Link text should tell the user where they will go if they follow the link. If two links on a page go to two different destinations, use different link text that accurately and concisely describes their destination.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 88,
"y": 38
},
"height": 38,
"width": 83
},
"position": {
"line": 6695,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\"><spa",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]",
"issueID": "f2e34ba36a7fd05608629be97c590275",
"signature": "2fa62828b05c304035523db9a794b9d7",
"ref": "https://tenon.io/bestpractice.php?bpID=105&tID=98&issueID=f2e34ba36a7fd05608629be97c590275"
},
{
"tID": 98,
"bpID": 105,
"priority": 100,
"level": [
"A",
"AAA"
],
"certainty": 100,
"errorTitle": "These links have the same text but different destinations.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 2.4.4 Link Purpose (In Context)",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.4.9 Link Purpose (Link Only)"
],
"resultTitle": "Don't reuse the same link text for links that have different destinations",
"errorDescription": "This link has the same text as another link that goes to a different place. Using the same text for multiple links which point to different pages is ambiguous and may be confusing for assistive technology users, or for users who have a cognitive disability. Link text should tell the user where they will go if they follow the link. If two links on a page go to two different destinations, use different link text that accurately and concisely describes their destination.",
"viewPortLocation": {
"top-left": {
"x": 442.25,
"y": 0
},
"bottom-right": {
"x": 532.25,
"y": 59
},
"height": 59,
"width": 90
},
"position": {
"line": 7007,
"column": 33
},
"errorSnippet": "<a href=\"/ad5/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">AD5</a>",
"xpath": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[4]/div[1]/div[1]/p[1]/a[1]",
"issueID": "30b08df8130c8a409a63612e64ad7f2c",
"signature": "2dec0aa69f72736d415250f73f195d8f",
"ref": "https://tenon.io/bestpractice.php?bpID=105&tID=98&issueID=30b08df8130c8a409a63612e64ad7f2c"
},
{
"tID": 134,
"bpID": 211,
"priority": 66,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "Very small text found.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This text's CSS `font-size` is set very small. This text is going to be difficult to read, especially for those who are partially sighted or have low-vision. Update the CSS `font-size` value to use a larger value.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 0,
"y": 0
},
"height": 0,
"width": 0
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\"> <g id=\"close-popup\" stroke",
"xpath": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]",
"issueID": "324c42a59b81424fa5cf4555efe64b3a",
"signature": "134f1dfe82d7b5908894fff250c06be0",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=134&issueID=324c42a59b81424fa5cf4555efe64b3a"
},
{
"tID": 134,
"bpID": 211,
"priority": 66,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "Very small text found.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This text's CSS `font-size` is set very small. This text is going to be difficult to read, especially for those who are partially sighted or have low-vision. Update the CSS `font-size` value to use a larger value.",
"viewPortLocation": {
"top-left": {
"x": -82,
"y": -82
},
"bottom-right": {
"x": -50,
"y": -50
},
"height": 32,
"width": 32
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\"> <g id=\"close-popup\" stroke",
"xpath": "/html/body/div[2]/div[2]/div[1]/div[1]",
"issueID": "1f3b7bdcbaad2be5918e85ce5a45379e",
"signature": "064fcf712bdce9d81d01377e8a349e17",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=134&issueID=1f3b7bdcbaad2be5918e85ce5a45379e"
},
{
"tID": 144,
"bpID": 14,
"priority": 91,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This content's line height is insufficent to properly display the computed element font size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 1.4.8 Visual Presentation"
],
"resultTitle": "Set a `line-height` (leading) that is at least one and a half times the current font size.",
"errorDescription": "This content's line height is insufficent to properly display the computed element font size. Line height that is less than 150% of the computed element font size limits content readability for people with dyslexia, low vision, cognitive impairments or learning disabilities. Set the `line-height` for this content to a value of 1.5 or higher. Using a proportional, unitless value like 1.5 or 150% will ensure that the line-height scales if the user zooms the browser window.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 27
},
"bottom-right": {
"x": 1024,
"y": 3340.09
},
"height": 3313.09,
"width": 1024
},
"position": {
"line": 2703,
"column": 61892
},
"errorSnippet": "<div class=\"brz-root__container brz-reset-all brz-mm-page brz-mm-slideout\" id=\"mm-0\"><nav id=\"asmnvqfvmmootnluikvnozrkjelxspuhkucy\" class=\"brz-menu brz-menu__mmenu brz-menu--has-dropdown brz-menu__preview brz-css-fpfjx brz-css-wjjfv brz-mm-menu ",
"xpath": "/html/body/div[1]",
"issueID": "d48a8b60de3361307161aa8e28130754",
"signature": "4475bf4e938a8f3733bc94bdf673e2f4",
"ref": "https://tenon.io/bestpractice.php?bpID=14&tID=144&issueID=d48a8b60de3361307161aa8e28130754"
},
{
"tID": 144,
"bpID": 14,
"priority": 91,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This content's line height is insufficent to properly display the computed element font size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 1.4.8 Visual Presentation"
],
"resultTitle": "Set a `line-height` (leading) that is at least one and a half times the current font size.",
"errorDescription": "This content's line height is insufficent to properly display the computed element font size. Line height that is less than 150% of the computed element font size limits content readability for people with dyslexia, low vision, cognitive impairments or learning disabilities. Set the `line-height` for this content to a value of 1.5 or higher. Using a proportional, unitless value like 1.5 or 150% will ensure that the line-height scales if the user zooms the browser window.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 39
},
"bottom-right": {
"x": 849.547,
"y": 156
},
"height": 117,
"width": 849.547
},
"position": {
"line": 10644,
"column": 0
},
"errorSnippet": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"><span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th Distr",
"xpath": "/html/body/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]",
"issueID": "8415bf2dab1d64a4a0bce89723cda26e",
"signature": "69f80fc844b16dd5d7c75c4ec709491d",
"ref": "https://tenon.io/bestpractice.php?bpID=14&tID=144&issueID=8415bf2dab1d64a4a0bce89723cda26e"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": -40,
"y": -20
},
"height": -20,
"width": -40
},
"position": {
"line": 2703,
"column": 0
},
"errorSnippet": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page brz-mm-listitem__text\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">TV</span></a>",
"xpath": "/html/body/div[1]/nav[1]/div[1]/div[1]/ul[1]/li[2]/div[1]/ul[1]/li[1]/a[1]",
"issueID": "1285536b8b933d7022dd8331701567aa",
"signature": "27ee4cd1b40761780d7fdfcd10beeead",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=1285536b8b933d7022dd8331701567aa"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": -40,
"y": -20
},
"height": -20,
"width": -40
},
"position": {
"line": 2703,
"column": 0
},
"errorSnippet": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page brz-mm-listitem__text\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">AD5</span></a>",
"xpath": "/html/body/div[1]/nav[1]/div[1]/div[1]/ul[1]/li[4]/a[1]",
"issueID": "3956b79681ff943270b4f51481af331c",
"signature": "ecb4d3c7e30089a46ec0dcb8e154b127",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=3956b79681ff943270b4f51481af331c"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 250,
"y": 24
},
"height": 24,
"width": 250
},
"position": {
"line": 2703,
"column": 0
},
"errorSnippet": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">TV</span></a>",
"xpath": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/ul[1]/li[1]/a[1]",
"issueID": "d8c161d741f74939fb8e98d04983e1e8",
"signature": "f4a129b14c3ecc280503257f5b2d27ab",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=d8c161d741f74939fb8e98d04983e1e8"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 246.40625,
"y": 39
},
"bottom-right": {
"x": 299.40625,
"y": 78
},
"height": 39,
"width": 53
},
"position": {
"line": 2703,
"column": 0
},
"errorSnippet": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">AD5</span></a>",
"xpath": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]",
"issueID": "3e335d110e67c2ec7a56f091ae2b1b84",
"signature": "7d2a7b398f9a1b8364745e5ce0063a3a",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=3e335d110e67c2ec7a56f091ae2b1b84"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 0,
"y": 0
},
"height": 0,
"width": 0
},
"position": {
"line": 2733,
"column": 1090
},
"errorSnippet": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\"><span class=\"brz-span brz-icon css-3z2g66\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0",
"xpath": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]",
"issueID": "0e7e90108c76552c075b817dc567f06f",
"signature": "e25d41aa9c62af97f83f3458a7e415f4",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=0e7e90108c76552c075b817dc567f06f"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": -82,
"y": -16
},
"height": -16,
"width": -82
},
"position": {
"line": 3743,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdg",
"xpath": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"issueID": "ad4a22d38f92cb39d176277b1e6abc3f",
"signature": "9571a9664e8b13ef41c35362d44927f0",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=ad4a22d38f92cb39d176277b1e6abc3f"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": -82,
"y": -16
},
"height": -16,
"width": -82
},
"position": {
"line": 3743,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufz",
"xpath": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/a[1]",
"issueID": "44a6e83c08c7444795d0a0b2bda4a7e5",
"signature": "1ca19114aa41039cd8b6612c22aa117f",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=44a6e83c08c7444795d0a0b2bda4a7e5"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": -82,
"y": -16
},
"height": -16,
"width": -82
},
"position": {
"line": 3759,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurw",
"xpath": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[3]/a[1]",
"issueID": "c27546c3710aec46050225a175762a64",
"signature": "2ed0a5a68ea26ec209d079976a36c128",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=c27546c3710aec46050225a175762a64"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 33,
"y": 38
},
"height": 38,
"width": 28
},
"position": {
"line": 6335,
"column": 34
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauw",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]",
"issueID": "65dc8d48de84c3ea8b149b177e1613d3",
"signature": "16c5e2596f8d26175412e04c39c2dd2d",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=65dc8d48de84c3ea8b149b177e1613d3"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 45,
"y": 38
},
"height": 38,
"width": 40
},
"position": {
"line": 6336,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmns",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]",
"issueID": "a77b2177d5ed40df2134f196fb73f7c3",
"signature": "7418ad3f228a8ff192a5a92f51563147",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=a77b2177d5ed40df2134f196fb73f7c3"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 47,
"y": 38
},
"height": 38,
"width": 42
},
"position": {
"line": 6336,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimueh",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]",
"issueID": "6615c66346d74dbb6650d02f83f71940",
"signature": "b90f821dcb81ac755f86c50bf6c7cf0c",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=6615c66346d74dbb6650d02f83f71940"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 49,
"y": 38
},
"height": 38,
"width": 44
},
"position": {
"line": 6336,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabz",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]",
"issueID": "1cd4327d4df27c2ccbbb0d1924418643",
"signature": "64c5ba76bf039be1c596a3df44ef3533",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=1cd4327d4df27c2ccbbb0d1924418643"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 47,
"y": 38
},
"height": 38,
"width": 42
},
"position": {
"line": 6336,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzyt",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]",
"issueID": "1ab221cc52db29f48310babc22b35736",
"signature": "11072935fe9aaa44fa77b5907da534a2",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=1ab221cc52db29f48310babc22b35736"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 250,
"y": 24
},
"height": 24,
"width": 250
},
"position": {
"line": 6696,
"column": 0
},
"errorSnippet": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">TV</span></a>",
"xpath": "/html/body/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/ul[1]/li[1]/a[1]",
"issueID": "cc579ad03b07adebbf112acdb02d3f8a",
"signature": "5f500c0b415432e1f09be5a58b45fabd",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=cc579ad03b07adebbf112acdb02d3f8a"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 413,
"y": 0
},
"bottom-right": {
"x": 460,
"y": 38
},
"height": 38,
"width": 47
},
"position": {
"line": 6863,
"column": 34
},
"errorSnippet": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">AD5</span></a>",
"xpath": "/html/body/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]",
"issueID": "cf82da4f8f73b576c714759e511d3c7e",
"signature": "a90122f70567c6edfb0d3ac383cf336a",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=cf82da4f8f73b576c714759e511d3c7e"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 14,
"y": 6.234375
},
"bottom-right": {
"x": 46,
"y": 23.234375
},
"height": 17,
"width": 32
},
"position": {
"line": 6864,
"column": 0
},
"errorSnippet": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1yqt0eo\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmln",
"xpath": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"issueID": "81347615a1a3da94ea5f18c58da60fda",
"signature": "72399ec794199879e2b40b6f460c94cd",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=81347615a1a3da94ea5f18c58da60fda"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 14,
"y": 6.234375
},
"bottom-right": {
"x": 46,
"y": 23.234375
},
"height": 17,
"width": 32
},
"position": {
"line": 6864,
"column": 0
},
"errorSnippet": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1ldonqd\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http:/",
"xpath": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
"issueID": "37592387e57391711ff2d3c0151348fd",
"signature": "b16b2c16fb6d3048b9a0a086bc35dfbf",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=37592387e57391711ff2d3c0151348fd"
},
{
"tID": 152,
"bpID": 211,
"priority": 88,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This actionable element is smaller than the minimum required size.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This actionable element is smaller than the stated minimum defined by all mobile platform developer guides. Minimum sizes for actionable elements ensure that those elements can be operated by people with vision, motor and cognitive disabilities. Even if this system is not explicitly intended for mobile use, it should be enlarged with CSS to meet minimu requirements and improve usability for users with vision, motor and cognitive disabilities.",
"viewPortLocation": {
"top-left": {
"x": 442.25,
"y": 0
},
"bottom-right": {
"x": 532.25,
"y": 59
},
"height": 59,
"width": 90
},
"position": {
"line": 7007,
"column": 33
},
"errorSnippet": "<a href=\"/ad5/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">AD5</a>",
"xpath": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[4]/div[1]/div[1]/p[1]/a[1]",
"issueID": "748c90d61cd66ab35f7a3266208bc77b",
"signature": "2aaac93c04e4c7a7e44e24f980f715f8",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=152&issueID=748c90d61cd66ab35f7a3266208bc77b"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 1164.96875
},
"bottom-right": {
"x": 1024,
"y": 1372.96875
},
"height": 208,
"width": 1024
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<section data-uid=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" id=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" class=\"brz-section brz-css-czgqm\"><div class=\"brz-section__content brz-section--boxed brz-css-zolan brz-css-tqjtr\" data-custom-id=\"fjymvqgtsdmorst",
"xpath": "/html/body/div[1]/section[4]",
"issueID": "f0e8ab7bd277926b56c786e9b30c8f66",
"signature": "af1d60fe112cdf757ccd2a2f389d95eb",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=f0e8ab7bd277926b56c786e9b30c8f66"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 1024,
"y": 178
},
"height": 178,
"width": 1024
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-section__content brz-section--boxed brz-css-zolan brz-css-tqjtr\" data-custom-id=\"fjymvqgtsdmorstyquyicrxdayzfxqqzydbv\"><div class=\"brz-bg\"><div class=\"brz-bg-color\"></div></div><div class=\"brz-container br",
"xpath": "/html/body/div[1]/section[4]/div[1]",
"issueID": "daaf930367b7fd4609298d79f032bf89",
"signature": "1d36c9e09aa834954132e47be8b5b0b3",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=daaf930367b7fd4609298d79f032bf89"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 15
},
"bottom-right": {
"x": 1024,
"y": 193
},
"height": 178,
"width": 1024
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-container brz-css-srmim\"><div class=\"brz-row__container brz-css-kdbze brz-css-iahci\" data-custom-id=\"ybauywqstiqnbnseenpzobxhinhvksiwxvvo\"><div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-columns brz-css-pnewc brz-c",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]",
"issueID": "4c923561f98e66c92b846419d29d8a60",
"signature": "54558ba59266555a40b7256c5f266982",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=4c923561f98e66c92b846419d29d8a60"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 1024,
"y": 178
},
"height": 178,
"width": 1024
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-row__container brz-css-kdbze brz-css-iahci\" data-custom-id=\"ybauywqstiqnbnseenpzobxhinhvksiwxvvo\"><div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-columns brz-css-pnewc brz-css-hvddm\" data-custom-id=\"afhxebdaipjaqtqnbrqby",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]",
"issueID": "fb2e04a1c9f8061bbe2d8135f6dee9f7",
"signature": "a503257042bf9099706415a71e5e4a72",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=fb2e04a1c9f8061bbe2d8135f6dee9f7"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 1004,
"y": 158
},
"height": 158,
"width": 1004
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-columns brz-css-pnewc brz-css-hvddm\" data-custom-id=\"afhxebdaipjaqtqnbrqbyuldslmkbkghsnvv\"><div class=\"brz-column__items brz-css-qjcof\"><div class=\"brz-css-aebhg brz-wrapper\"><",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]",
"issueID": "464b258227035f22607d530a1f140a56",
"signature": "879bb442303a9dab6696b9d330e7aebe",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=464b258227035f22607d530a1f140a56"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": -844.7999877929688
},
"bottom-right": {
"x": 1024,
"y": -76.79998779296875
},
"height": 768,
"width": 1024
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-coyvp\" id=\"gfvfkzeiseiarwaanpeufzkocrfwprktavbj\" data-brz-popup=\"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-click_outside_to_close=\"true\" data-custom-id=\"zvpudqmsabbezjv",
"xpath": "/html/body/div[2]",
"issueID": "26a835e0173776d0060922a18cbd9aab",
"signature": "26484d13527fb4538fb36269e314787a",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=26a835e0173776d0060922a18cbd9aab"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 1024,
"y": 768
},
"height": 768,
"width": 1024
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-popup2__inner brz-d-xs-flex brz-flex-xs-wrap brz-css-mukys brz-css-jyuit\"><div class=\"brz-container__wrap\"><div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns",
"xpath": "/html/body/div[2]/div[2]",
"issueID": "666115140c19f7bcb39d666a72425101",
"signature": "5d980a50b16633a12443ed69797a2141",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=666115140c19f7bcb39d666a72425101"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 92.5
},
"bottom-right": {
"x": 1024,
"y": 675.5
},
"height": 583,
"width": 1024
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-container__wrap\"><div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-p",
"xpath": "/html/body/div[2]/div[2]/div[1]",
"issueID": "afc70670ec49decbc8268a1b50292fe8",
"signature": "56ac95ec3c4a8663e0bc0f9c50bd0d22",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=afc70670ec49decbc8268a1b50292fe8"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 1024,
"y": 583
},
"height": 583,
"width": 1024
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-container\"><div class=\"brz-row__container brz-css-kdbze brz-css-gtzcc\" data-custom-id=\"fbynwrashgprpckenogocymmoinjqfdyvata\"><div class=\"brz-bg\"></div><div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-col",
"xpath": "/html/body/div[2]/div[2]/div[1]/div[2]",
"issueID": "dc126bb0243e8c958ddff23ba1b4752c",
"signature": "da4c25f106bb06af0198ed701fed0fa6",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=dc126bb0243e8c958ddff23ba1b4752c"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 1024,
"y": 583
},
"height": 583,
"width": 1024
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-row__container brz-css-kdbze brz-css-gtzcc\" data-custom-id=\"fbynwrashgprpckenogocymmoinjqfdyvata\"><div class=\"brz-bg\"></div><div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-columns brz-css-pnewc brz-css-xgwrh\"",
"xpath": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]",
"issueID": "c0c47333da454fed2134bd814621fef6",
"signature": "bfd648ee1ba495326dca81eb1c5182ae",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=c0c47333da454fed2134bd814621fef6"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 1004,
"y": 563
},
"height": 563,
"width": 1004
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-columns brz-css-pnewc brz-css-xgwrh\" data-custom-id=\"tvspchztbgeujqmlnflflrmwskqvxaumskqn\"><div class=\"brz-column__items brz-css-qjcof\"><div class=\"brz-css-aebhg brz-wrapper\"><",
"xpath": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]/div[2]",
"issueID": "c2ddeb59fcbb2513e13815ad61dc7b5c",
"signature": "a89a510849893ff969280cb502f035c3",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=c2ddeb59fcbb2513e13815ad61dc7b5c"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 10,
"y": 10
},
"bottom-right": {
"x": 1014,
"y": 573
},
"height": 563,
"width": 1004
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-columns brz-css-pnewc brz-css-xgwrh\" data-custom-id=\"tvspchztbgeujqmlnflflrmwskqvxaumskqn\"><div class=\"brz-column__items brz-css-qjcof\"><div class=\"brz-css-aebhg brz-wrapper\"><div class=\"brz-rich-text brz-rich-text__c",
"xpath": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]/div[2]/div[1]",
"issueID": "930e308d48a8a4bd667df4828d10730d",
"signature": "88a97990d9e799a8edf7bd32fdaa9815",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=930e308d48a8a4bd667df4828d10730d"
},
{
"tID": 153,
"bpID": 211,
"priority": 85,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 60,
"errorTitle": "This long string of text is in all caps.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This element contains a long passage of text that is capitalized, either in the text itself or via CSS text-transform. Capitalized text can be very difficult to read for users with dyslexia Modify this passage of text so that it is no longer all in upper case. Changing this to sentence case will result in significant improvements in readability.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": 974,
"y": 553
},
"height": 553,
"width": 974
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-column__items brz-css-qjcof\"><div class=\"brz-css-aebhg brz-wrapper\"><div class=\"brz-rich-text brz-rich-text__custom brz-css-iqefg\" data-custom-id=\"xdjpffwicbvalfxxfiughozwmvqbywdxdqdf\"><div><p class=\"brz-css-rjz",
"xpath": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]",
"issueID": "a053d6c5bae7ca4d5014cff97ba687a6",
"signature": "5713cb2ba27323151061c9ed1167e83a",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=153&issueID=a053d6c5bae7ca4d5014cff97ba687a6"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 150,
"y": 48
},
"height": 48,
"width": 145
},
"position": {
"line": 3738,
"column": 5796
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\"><svg",
"xpath": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]",
"issueID": "626c8ad1806227c89b207b8c825ed047",
"signature": "8b250a6bf4aa7895d305152855e67cd6",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=626c8ad1806227c89b207b8c825ed047"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": -82,
"y": -16
},
"height": -16,
"width": -82
},
"position": {
"line": 3743,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdg",
"xpath": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"issueID": "5e7b5c0b3ff9ea1804643bdd83d4a93c",
"signature": "56f2c851bf64e9cbbab4f8b8d4c549c5",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=5e7b5c0b3ff9ea1804643bdd83d4a93c"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": -82,
"y": -16
},
"height": -16,
"width": -82
},
"position": {
"line": 3743,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufz",
"xpath": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/a[1]",
"issueID": "65e738b154b0b8584c390c78c68cffd4",
"signature": "eeaab90a1f7c81baf35a2429f24c9503",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=65e738b154b0b8584c390c78c68cffd4"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": -82,
"y": -16
},
"height": -16,
"width": -82
},
"position": {
"line": 3759,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurw",
"xpath": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[3]/a[1]",
"issueID": "4130b005e96276ae1aaa0c359144217b",
"signature": "a70dcbd7ef5b6a2511c93f9236f9b949",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=4130b005e96276ae1aaa0c359144217b"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 0
},
"bottom-right": {
"x": -82,
"y": -16
},
"height": -16,
"width": -82
},
"position": {
"line": 3759,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-cbllz\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yemcvnewgngfymiotxewwyjzajhaeldnceah\"&g",
"xpath": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[4]/a[1]",
"issueID": "5106ece53177782ffe803f92f3d98714",
"signature": "d220748d92a26935c7441ccdf83e2625",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=5106ece53177782ffe803f92f3d98714"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 33,
"y": 38
},
"height": 38,
"width": 28
},
"position": {
"line": 6335,
"column": 34
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauw",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]",
"issueID": "a1b03c2085e03a14691829aa3c29628c",
"signature": "a39b45caad2d9704658a3b7434f0d515",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=a1b03c2085e03a14691829aa3c29628c"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 45,
"y": 38
},
"height": 38,
"width": 40
},
"position": {
"line": 6336,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmns",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]",
"issueID": "5c9ccf557c6f6f1c07c8d39877ba3d89",
"signature": "45b7778f8776ce6f4c3903c98ac545f7",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=5c9ccf557c6f6f1c07c8d39877ba3d89"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 47,
"y": 38
},
"height": 38,
"width": 42
},
"position": {
"line": 6336,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimueh",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]",
"issueID": "454832894ac6b1156ea6453639c5efef",
"signature": "b960d9bcc97d26a82f2a6c3e1aca9cdb",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=454832894ac6b1156ea6453639c5efef"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 49,
"y": 38
},
"height": 38,
"width": 44
},
"position": {
"line": 6336,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabz",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]",
"issueID": "412ab2a602c033eec547c9db6bbef732",
"signature": "1c3665aae06302ba9be480bb9a45b517",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=412ab2a602c033eec547c9db6bbef732"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 47,
"y": 38
},
"height": 38,
"width": 42
},
"position": {
"line": 6336,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzyt",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]",
"issueID": "ad41d60b20afa99a9e29a0b17db9d7cb",
"signature": "b205ac68c5bca49ad0e3a0441f666a86",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=ad41d60b20afa99a9e29a0b17db9d7cb"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 5,
"y": 0
},
"bottom-right": {
"x": 88,
"y": 38
},
"height": 38,
"width": 83
},
"position": {
"line": 6695,
"column": 0
},
"errorSnippet": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\"><spa",
"xpath": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]",
"issueID": "ac499e43b08959b02206092d3d9174c9",
"signature": "560fbd3f070803c78d6d9f5c4283cab1",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=ac499e43b08959b02206092d3d9174c9"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 14,
"y": 6.234375
},
"bottom-right": {
"x": 46,
"y": 23.234375
},
"height": 17,
"width": 32
},
"position": {
"line": 6864,
"column": 0
},
"errorSnippet": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1yqt0eo\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmln",
"xpath": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]",
"issueID": "fb6b739e3af32ba5a59dc22b99ab6ccc",
"signature": "07fdfa4a9019cc1b66f3bdd1c5f9e5ee",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=fb6b739e3af32ba5a59dc22b99ab6ccc"
},
{
"tID": 218,
"bpID": 207,
"priority": 88,
"level": [
"AAA"
],
"certainty": 100,
"errorTitle": "This link opens in a new window without user control.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 3.2.5 Change on Request"
],
"resultTitle": "Notify the user when links will open new windows or tabs",
"errorDescription": "This link opens in a new window without user control. Opening a new window or new tab unexpectedly can cause confusion for users, particularly for blind users and those with low vision, cogntive impairments or learning disabilities.. Avoid opening links in new windows or tabs. If it is unavoidable, give the user warning via text or a properly marked up and appropriate icon.",
"viewPortLocation": {
"top-left": {
"x": 14,
"y": 6.234375
},
"bottom-right": {
"x": 46,
"y": 23.234375
},
"height": 17,
"width": 32
},
"position": {
"line": 6864,
"column": 0
},
"errorSnippet": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1ldonqd\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http:/",
"xpath": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]",
"issueID": "e4138660286d60d3bf65ec9bcb29d5ab",
"signature": "812641c94655d5a3346729690982722d",
"ref": "https://tenon.io/bestpractice.php?bpID=207&tID=218&issueID=e4138660286d60d3bf65ec9bcb29d5ab"
},
{
"tID": 271,
"bpID": 211,
"priority": 100,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This text is rotated from the horizontal by 60 degrees or more.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This text is rotated from the horizontal by 60 degrees or more, and is not part of a complex image or graphic. Text rotated beyond a certain threshold presents comprehension difficulties for people with cognitive disabilities or perception-based learning disabilities. Don't rotate text beyond 60 degrees from the horiziontal.",
"viewPortLocation": {
"top-left": {
"x": 0,
"y": 902
},
"bottom-right": {
"x": 1024,
"y": 1002
},
"height": 100,
"width": 1024
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<div class=\"brz-bg-shape brz-bg-shape__bottom\"></div>",
"xpath": "/html/body/div[1]/section[2]/div[1]/div[1]/div[3]",
"issueID": "82475b29309223cedd94278827f288ab",
"signature": "a18649539352f62cf0cb76e4d4bd299e",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=271&issueID=82475b29309223cedd94278827f288ab"
},
{
"tID": 271,
"bpID": 211,
"priority": 100,
"level": [
"A",
"AA",
"AAA"
],
"certainty": 100,
"errorTitle": "This text is rotated from the horizontal by 60 degrees or more.",
"standards": [
"Web Content Accessibility Guidelines (WCAG) 2.0, Level A: 1.3.1 Info and Relationships",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.5 Images of Text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 3.2.4 Consistent Identification",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AA: 1.4.4 Resize text",
"Web Content Accessibility Guidelines (WCAG) 2.0, Level AAA: 2.5.5 Target Size"
],
"resultTitle": "Ensure content is legible.",
"errorDescription": "This text is rotated from the horizontal by 60 degrees or more, and is not part of a complex image or graphic. Text rotated beyond a certain threshold presents comprehension difficulties for people with cognitive disabilities or perception-based learning disabilities. Don't rotate text beyond 60 degrees from the horiziontal.",
"viewPortLocation": {
"top-left": {
"x": -79.07681274414062,
"y": -831.2999877929688
},
"bottom-right": {
"x": -79.07681274414062,
"y": -831.2999877929688
},
"height": 0,
"width": 0
},
"position": {
"line": 10645,
"column": 0
},
"errorSnippet": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>",
"xpath": "/html/body/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[2]",
"issueID": "b5130d3ebc4c60199d955f91717f379d",
"signature": "9450670a10af0da2846169d124000ced",
"ref": "https://tenon.io/bestpractice.php?bpID=211&tID=271&issueID=b5130d3ebc4c60199d955f91717f379d"
}
],
"log": []
},
"success": true
},
"standardResult": {
"totals": [
0,
0,
15,
48
],
"instances": [
{
"ruleID": "28",
"what": "The layout or sizing of this page causes horizontal scrolling.",
"ordinalSeverity": 3,
"tagName": "BODY",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body"
},
"excerpt": "<body class=\"home page-template page-template-brizy-blank-template page-template-brizy-blank-template-php page page-id-16 wp-custom-logo ast-single-post ast-inherit-site-logo-transparent ast-hfb-header ast-desktop ast-plain-container ast-no-sidebar as"
},
{
"ruleID": "36",
"what": "This text is justified.",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]"
},
"excerpt": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"><span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th Distr"
},
{
"ruleID": "36",
"what": "This text is justified.",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]/span[1]"
},
"excerpt": "<span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th District at the State Capitol. </span>"
},
{
"ruleID": "57",
"what": "This link has no text inside it.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qxtypykllvxjdqovvbtncnbmgsxknqcdrmaa\"><picture class=\"brz-picture brz-d-block brz-p-relative brz-css-ptqop\"><img decoding=\"async\" class=\""
},
{
"ruleID": "57",
"what": "This link has no text inside it.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\"><span class=\"brz-span brz-icon css-3z2g66\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0"
},
{
"ruleID": "57",
"what": "This link has no text inside it.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1yqt0eo\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmln"
},
{
"ruleID": "57",
"what": "This link has no text inside it.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1ldonqd\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http:/"
},
{
"ruleID": "73",
"what": "This link text is uninformative.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[6]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[4]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sojez\" href=\"/about/\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uetggdqlcmtrhlfffcvstclsvnymedkfmwzm\"><span class=\"brz-span brz-text__editor\">Learn More</span></a>"
},
{
"ruleID": "98",
"what": "These links have the same text but different destinations.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauw"
},
{
"ruleID": "98",
"what": "These links have the same text but different destinations.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmns"
},
{
"ruleID": "98",
"what": "These links have the same text but different destinations.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimueh"
},
{
"ruleID": "98",
"what": "These links have the same text but different destinations.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\"><spa"
},
{
"ruleID": "98",
"what": "These links have the same text but different destinations.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[4]/div[1]/div[1]/p[1]/a[1]"
},
"excerpt": "<a href=\"/ad5/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">AD5</a>"
},
{
"ruleID": "134",
"what": "Very small text found.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[2]/div[2]/div[2]/div[1]/div[1]"
},
"excerpt": "<div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\"> <g id=\"close-popup\" stroke"
},
{
"ruleID": "134",
"what": "Very small text found.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]/div[1]/div[1]"
},
"excerpt": "<div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-popup\"> <g id=\"close-popup\" stroke"
},
{
"ruleID": "144",
"what": "This content's line height is insufficent to properly display the computed element font size.",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "mm-0",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]"
},
"excerpt": "<div class=\"brz-root__container brz-reset-all brz-mm-page brz-mm-slideout\" id=\"mm-0\"><nav id=\"asmnvqfvmmootnluikvnozrkjelxspuhkucy\" class=\"brz-menu brz-menu__mmenu brz-menu--has-dropdown brz-menu__preview brz-css-fpfjx brz-css-wjjfv brz-mm-menu "
},
{
"ruleID": "144",
"what": "This content's line height is insufficent to properly display the computed element font size.",
"ordinalSeverity": 3,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[2]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/p[2]"
},
"excerpt": "<p class=\"brz-css-aesxw\" data-generated-css=\"brz-css-armam\" data-uniq-id=\"nwtym\"><span class=\"brz-cp-color3\">Thank you for choosing me to represent you in the State Assembly. I am humbled by your support and honored to represent the 5th Distr"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/nav[1]/div[1]/div[1]/ul[1]/li[2]/div[1]/ul[1]/li[1]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page brz-mm-listitem__text\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">TV</span></a>"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/nav[1]/div[1]/div[1]/ul[1]/li[4]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page brz-mm-listitem__text\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">AD5</span></a>"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/ul[1]/li[1]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">TV</span></a>"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">AD5</span></a>"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\"><span class=\"brz-span brz-icon css-3z2g66\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" x=\"0"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdg"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufz"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[3]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurw"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauw"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmns"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimueh"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabz"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzyt"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[2]/ul[1]/li[1]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/endorsed-tv-ad/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">TV</span></a>"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/footer[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/nav[1]/ul[1]/li[4]/a[1]"
},
"excerpt": "<a class=\"brz-a menu-item menu-item-type-post_type menu-item-object-page\" href=\"https://joepatterson.com/ad5/\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span\">AD5</span></a>"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1yqt0eo\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmln"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1ldonqd\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http:/"
},
{
"ruleID": "152",
"what": "This actionable element is smaller than the minimum required size.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]/div[4]/div[1]/div[1]/p[1]/a[1]"
},
"excerpt": "<a href=\"/ad5/\" style=\"\" class=\"brz-cp-color8 link--external\" data-brz-link-type=\"external\">AD5</a>"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "SECTION",
"id": "tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]"
},
"excerpt": "<section data-uid=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" id=\"tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq\" class=\"brz-section brz-css-czgqm\"><div class=\"brz-section__content brz-section--boxed brz-css-zolan brz-css-tqjtr\" data-custom-id=\"fjymvqgtsdmorst"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]"
},
"excerpt": "<div class=\"brz-section__content brz-section--boxed brz-css-zolan brz-css-tqjtr\" data-custom-id=\"fjymvqgtsdmorstyquyicrxdayzfxqqzydbv\"><div class=\"brz-bg\"><div class=\"brz-bg-color\"></div></div><div class=\"brz-container br"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]"
},
"excerpt": "<div class=\"brz-container brz-css-srmim\"><div class=\"brz-row__container brz-css-kdbze brz-css-iahci\" data-custom-id=\"ybauywqstiqnbnseenpzobxhinhvksiwxvvo\"><div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-columns brz-css-pnewc brz-c"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]"
},
"excerpt": "<div class=\"brz-row__container brz-css-kdbze brz-css-iahci\" data-custom-id=\"ybauywqstiqnbnseenpzobxhinhvksiwxvvo\"><div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-columns brz-css-pnewc brz-css-hvddm\" data-custom-id=\"afhxebdaipjaqtqnbrqby"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]"
},
"excerpt": "<div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-columns brz-css-pnewc brz-css-hvddm\" data-custom-id=\"afhxebdaipjaqtqnbrqbyuldslmkbkghsnvv\"><div class=\"brz-column__items brz-css-qjcof\"><div class=\"brz-css-aebhg brz-wrapper\"><"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "gfvfkzeiseiarwaanpeufzkocrfwprktavbj",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]"
},
"excerpt": "<div class=\"brz-popup2 brz-popup2__preview brz-simple-popup brz-css-gslrb brz-css-coyvp\" id=\"gfvfkzeiseiarwaanpeufzkocrfwprktavbj\" data-brz-popup=\"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-click_outside_to_close=\"true\" data-custom-id=\"zvpudqmsabbezjv"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]"
},
"excerpt": "<div class=\"brz-popup2__inner brz-d-xs-flex brz-flex-xs-wrap brz-css-mukys brz-css-jyuit\"><div class=\"brz-container__wrap\"><div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]/div[1]"
},
"excerpt": "<div class=\"brz-container__wrap\"><div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http://www.w3.org/1999/xlink\" class=\"brz-icon-svg\" data-type=\"editor\" data-name=\"close-p"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]/div[1]/div[2]"
},
"excerpt": "<div class=\"brz-container\"><div class=\"brz-row__container brz-css-kdbze brz-css-gtzcc\" data-custom-id=\"fbynwrashgprpckenogocymmoinjqfdyvata\"><div class=\"brz-bg\"></div><div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-col"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]"
},
"excerpt": "<div class=\"brz-row__container brz-css-kdbze brz-css-gtzcc\" data-custom-id=\"fbynwrashgprpckenogocymmoinjqfdyvata\"><div class=\"brz-bg\"></div><div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-columns brz-css-pnewc brz-css-xgwrh\""
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]/div[2]"
},
"excerpt": "<div class=\"brz-row brz-css-dhyxb\"><div class=\"brz-columns brz-css-pnewc brz-css-xgwrh\" data-custom-id=\"tvspchztbgeujqmlnflflrmwskqvxaumskqn\"><div class=\"brz-column__items brz-css-qjcof\"><div class=\"brz-css-aebhg brz-wrapper\"><"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]/div[2]/div[1]"
},
"excerpt": "<div class=\"brz-columns brz-css-pnewc brz-css-xgwrh\" data-custom-id=\"tvspchztbgeujqmlnflflrmwskqvxaumskqn\"><div class=\"brz-column__items brz-css-qjcof\"><div class=\"brz-css-aebhg brz-wrapper\"><div class=\"brz-rich-text brz-rich-text__c"
},
{
"ruleID": "153",
"what": "This long string of text is in all caps.",
"ordinalSeverity": 2,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]/div[1]/div[2]/div[1]/div[2]/div[1]/div[1]"
},
"excerpt": "<div class=\"brz-column__items brz-css-qjcof\"><div class=\"brz-css-aebhg brz-wrapper\"><div class=\"brz-rich-text brz-rich-text__custom brz-css-iqefg\" data-custom-id=\"xdjpffwicbvalfxxfiughozwmvqbywdxdqdf\"><div><p class=\"brz-css-rjz"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[1]/div[1]/div[1]/div[2]/div[1]/div[1]/div[3]/div[2]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-xufry\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"wdkwtywxclkctgguzxllrsrxtabepbjediqo\"><svg"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-nemwk\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"iecilqiumgmczgnaouydoyabdg"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-sjqxo\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"ppitqvatbihawqwrdqkdqyufz"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[3]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-ofrgu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=25\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"qnpmdkbwrivufecpbzmmbwurw"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[3]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[4]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-cbllz\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yemcvnewgngfymiotxewwyjzajhaeldnceah\"&g"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-bftnv\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=5\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"egtlxgqvtvrvriiknojhvtrwucrlauw"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[2]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pihqw\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=10\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"yuoibwitwnifniuigiitgmansznmns"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[3]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-pqrak\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"rddyneueppnmzvpdaftarbnpzimueh"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[4]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-utxic\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2022/?eid=5297&amp;sd=50\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"uoncmctatgruuclhqhonxyabz"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[5]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-eawld\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/?eid&amp;sd=75\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"tunzsgmwxwmbmvbalcyswqpmhhqzyt"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[4]/div[1]/div[2]/div[1]/div[1]/div[2]/div[1]/div[1]/div[1]/div[6]/a[1]"
},
"excerpt": "<a class=\"brz-a brz-btn brz-css-ystbj brz-css-oueeu\" href=\"https://www.efundraisingconnections.com/c/JoePatterson2024/\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\" data-custom-id=\"negepnodaliscnsjclnlznsimatziovugbtb\"><spa"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1yqt0eo\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmln"
},
{
"ruleID": "218",
"what": "This link opens in a new window without user control.",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/footer[1]/div[2]/div[2]/div[1]/div[1]/div[1]/div[1]/div[1]/div[2]/div[1]/a[1]"
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-type=\"external\" id=\"\"><span class=\"brz-span brz-icon css-1ldonqd\"><svg version=\"1.1\" xmlns=\"http://www.w3.org/2000/svg\" xmlns:xlink=\"http:/"
},
{
"ruleID": "271",
"what": "This text is rotated from the horizontal by 60 degrees or more.",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[1]/section[2]/div[1]/div[1]/div[3]"
},
"excerpt": "<div class=\"brz-bg-shape brz-bg-shape__bottom\"></div>"
},
{
"ruleID": "271",
"what": "This text is rotated from the horizontal by 60 degrees or more.",
"ordinalSeverity": 3,
"tagName": "PATH",
"id": "Line-2",
"location": {
"doc": "dom",
"type": "xpath",
"spec": "/html/body/div[2]/div[2]/div[1]/div[1]/svg[1]/g[1]/path[2]"
},
"excerpt": "<path d=\"M1.5,1.5 L14.5384048,14.5384048\" id=\"Line-2\" stroke=\"currentColor\" fill-rule=\"nonzero\" transform=\"translate(8.000000, 8.000000) scale(-1, 1) translate(-8.000000, -8.000000) \"></path>"
}
]
},
"endTime": 1687099530678
},
{
"type": "test",
"which": "testaro",
"withItems": true,
"rules": [
"n",
"motion"
],
"startTime": 1687099530679,
"url": "https://joepatterson.com/",
"what": "Testaro",
"result": {
"rules": {
"allHidden": {
"what": "page that is entirely or mostly hidden",
"data": {
"hidden": {
"document": false,
"body": false,
"main": false
},
"reallyHidden": {
"document": false,
"body": false,
"main": false
},
"display": {
"document": "block",
"body": "block",
"main": null
},
"visHidden": {
"document": false,
"body": false,
"main": false
},
"ariaHidden": {
"document": false,
"body": false,
"main": false
},
"tagName": {
"document": "HTML",
"body": "BODY",
"main": ""
},
"id": {
"body": "",
"main": ""
}
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"autocomplete": {
"what": "name and email inputs without autocomplete attributes",
"data": {
"total": 3,
"items": [
[
"email",
"",
"#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx"
],
[
"email",
"",
"#mgyugaeqkddylcikxicljnzwriqlzqyqgmnp"
],
[
"email",
"",
"#chxlcwfzdkkzydlwngiklgablxhogbjfyjxn"
]
]
},
"totals": [
0,
0,
3,
0
],
"standardInstances": [
{
"ruleID": "autocomplete",
"what": "Input is missing the required autocomplete attribute with value email",
"ordinalSeverity": 2,
"tagName": "INPUT",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx"
},
{
"ruleID": "autocomplete",
"what": "Input is missing the required autocomplete attribute with value email",
"ordinalSeverity": 2,
"tagName": "INPUT",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "#mgyugaeqkddylcikxicljnzwriqlzqyqgmnp"
},
{
"ruleID": "autocomplete",
"what": "Input is missing the required autocomplete attribute with value email",
"ordinalSeverity": 2,
"tagName": "INPUT",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "#chxlcwfzdkkzydlwngiklgablxhogbjfyjxn"
}
]
},
"bulk": {
"what": "large count of visible elements",
"data": {
"visibleElements": 312
},
"totals": [
1,
0,
0,
0
],
"standardInstances": [
{
"ruleID": "bulk",
"what": "Page contains a large number of visible elements",
"count": 1,
"ordinalSeverity": 0,
"tagName": "HTML",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": ""
}
]
},
"docType": {
"what": "document without a doctype property",
"data": {
"docHasType": true
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"dupAtt": {
"what": "elements with duplicate attributes",
"data": {
"total": 0,
"items": []
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"embAc": {
"what": "active elements embedded in links or buttons",
"data": {
"totals": {
"links": 0,
"buttons": 0,
"inputs": 0,
"selects": 0
},
"items": []
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"filter": {
"what": "filter styles on elements",
"data": {
"totals": {
"styledElements": 0,
"impactedElements": 0
},
"items": []
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"focAll": {
"what": "discrepancies between focusable and Tab-focused elements",
"data": {
"tabFocusables": 34,
"tabFocused": 34,
"discrepancy": 0
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"focInd": {
"what": "missing and nonstandard focus indicators",
"data": {
"totals": {
"total": 34,
"types": {
"missing": {
"total": 34,
"tagNames": {
"A": 21,
"INPUT": 10,
"BUTTON": 3
}
},
"nonoutline": {
"total": 0,
"tagNames": {}
},
"outline": {
"total": 0,
"meanDelay": 0,
"tagNames": {}
}
}
},
"items": {
"missing": [
{
"tagName": "A",
"id": "",
"text": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id"
},
{
"tagName": "A",
"id": "",
"text": "Home"
},
{
"tagName": "A",
"id": "",
"text": "Meet Joe"
},
{
"tagName": "A",
"id": "",
"text": "News"
},
{
"tagName": "A",
"id": "",
"text": "AD5"
},
{
"tagName": "A",
"id": "",
"text": "Issues"
},
{
"tagName": "A",
"id": "",
"text": "DONATE"
},
{
"tagName": "A",
"id": "",
"text": "$5"
},
{
"tagName": "A",
"id": "",
"text": "$10"
},
{
"tagName": "A",
"id": "",
"text": "$25"
},
{
"tagName": "A",
"id": "",
"text": "$50"
},
{
"tagName": "A",
"id": "",
"text": "$75"
},
{
"tagName": "A",
"id": "",
"text": "OTHER"
},
{
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"text": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubyds"
},
{
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"text": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlom"
},
{
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"text": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsiv"
},
{
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"text": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafns"
},
{
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"text": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbq"
},
{
"tagName": "BUTTON",
"id": "",
"text": "SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!win"
},
{
"tagName": "A",
"id": "",
"text": "Learn More"
},
{
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"text": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdh"
},
{
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"text": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvl"
},
{
"tagName": "INPUT",
"id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"text": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpi"
},
{
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"text": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwp"
},
{
"tagName": "BUTTON",
"id": "",
"text": "Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}i"
},
{
"tagName": "A",
"id": "",
"text": "Home"
},
{
"tagName": "A",
"id": "",
"text": "Meet Joe"
},
{
"tagName": "A",
"id": "",
"text": "News"
},
{
"tagName": "A",
"id": "",
"text": "AD5"
},
{
"tagName": "A",
"id": "",
"text": "Issues"
},
{
"tagName": "INPUT",
"id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"text": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybx"
},
{
"tagName": "BUTTON",
"id": "",
"text": "SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!win"
},
{
"tagName": "A",
"id": "",
"text": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\""
},
{
"tagName": "A",
"id": "",
"text": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-"
}
],
"nonoutline": [],
"outline": []
}
},
"totals": [
0,
0,
0,
34
],
"standardInstances": [
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Home"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Issues"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "DONATE"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$5"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$10"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$25"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$50"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$75"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "OTHER"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubyds"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlom"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsiv"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafns"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbq"
},
{
"ruleID": "focInd",
"what": "BUTTON element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!win"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Learn More"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdh"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvl"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpi"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwp"
},
{
"ruleID": "focInd",
"what": "BUTTON element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}i"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Home"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Issues"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybx"
},
{
"ruleID": "focInd",
"what": "BUTTON element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!win"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\""
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-"
}
]
},
"focOp": {
"what": "discrepancies between focusability and operability",
"data": {
"totals": {
"total": 60,
"types": {
"onlyFocusable": {
"total": 0,
"tagNames": {}
},
"onlyOperable": {
"total": 2,
"tagNames": {
"DIV": 2
}
},
"focusableAndOperable": {
"total": 58,
"tagNames": {
"A": 45,
"INPUT": 10,
"BUTTON": 3
}
}
}
},
"items": {
"onlyFocusable": [],
"onlyOperable": [
{
"tagName": "DIV",
"id": "",
"text": "<div class=\"brz-popup2__close\" style=\"cursor: default;\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns",
"byTag": false,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "DIV",
"id": "",
"text": "<div class=\"brz-popup2__close\" style=\"cursor: default;\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns",
"byTag": false,
"byOnClick": false,
"byPointer": true
}
],
"focusableAndOperable": [
{
"tagName": "A",
"id": "",
"text": "Main Menu",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Home",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Meet Joe",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Toggle submenu",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "TV",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "News",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "AD5",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Issues",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Home",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Meet Joe",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "TV",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "News",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "AD5",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Issues",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\" style",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "HOME",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "DONATE",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "$5",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "$10",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "$25",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "OTHER",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "$5",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "$10",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "$25",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "$50",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "$75",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "OTHER",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"text": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubyds",
"byTag": true,
"byOnClick": false,
"byPointer": false
},
{
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"text": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlom",
"byTag": true,
"byOnClick": false,
"byPointer": false
},
{
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"text": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsiv",
"byTag": true,
"byOnClick": false,
"byPointer": false
},
{
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"text": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafns",
"byTag": true,
"byOnClick": false,
"byPointer": false
},
{
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"text": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbq",
"byTag": true,
"byOnClick": false,
"byPointer": false
},
{
"tagName": "BUTTON",
"id": "",
"text": "SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!win",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Learn More",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"text": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdh",
"byTag": true,
"byOnClick": false,
"byPointer": false
},
{
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"text": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvl",
"byTag": true,
"byOnClick": false,
"byPointer": false
},
{
"tagName": "INPUT",
"id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"text": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpi",
"byTag": true,
"byOnClick": false,
"byPointer": false
},
{
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"text": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwp",
"byTag": true,
"byOnClick": false,
"byPointer": false
},
{
"tagName": "BUTTON",
"id": "",
"text": "Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}i",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Home",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Meet Joe",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "TV",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "News",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "AD5",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Issues",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "INPUT",
"id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"text": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybx",
"byTag": true,
"byOnClick": false,
"byPointer": false
},
{
"tagName": "BUTTON",
"id": "",
"text": "SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!win",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\"",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "Close menu",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "HOME",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "MEET JOE",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "NEWS",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "AD5",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "ENDORSEMENTS",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "YARD SIGNS",
"byTag": true,
"byOnClick": false,
"byPointer": true
},
{
"tagName": "A",
"id": "",
"text": "VOLUNTEER",
"byTag": true,
"byOnClick": false,
"byPointer": true
}
]
}
},
"totals": [
0,
0,
0,
2
],
"standardInstances": [
{
"ruleID": "focOp",
"complaint": "DIV element is operable but not focusable",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-popup2__close\" style=\"cursor: default;\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns"
},
{
"ruleID": "focOp",
"complaint": "DIV element is operable but not focusable",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-popup2__close\" style=\"cursor: default;\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns"
}
]
},
"focVis": {
"what": "links that are invisible when focused",
"data": {
"total": 0,
"items": []
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"hover": {
"what": "hover-caused content changes",
"data": {
"totals": {
"triggers": 34,
"triggerSample": 18,
"impactTriggers": 2,
"additions": 7,
"removals": 0,
"opacityChanges": 0,
"opacityImpact": 0,
"unhoverables": 0,
"noCursors": 0,
"badCursors": 2,
"noIndicators": 0,
"badIndicators": 1
},
"items": {
"impactTriggers": [
{
"tagName": "LI",
"id": "",
"text": "Meet JoeTV",
"additions": 4,
"removals": 0,
"opacityChanges": 0,
"opacityImpact": 0
},
{
"tagName": "A",
"id": "",
"text": "Meet Joe",
"additions": 4,
"removals": 0,
"opacityChanges": 0,
"opacityImpact": 0
}
],
"unhoverables": [],
"noCursors": [],
"badCursors": [
{
"tagName": "BUTTON",
"id": "",
"text": "Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}i"
}
],
"noIndicators": [],
"badIndicators": [
{
"tagName": "LI",
"id": "",
"text": "News"
}
]
}
},
"totals": [
0,
7,
3,
2
],
"standardInstances": [
{
"ruleID": "hover",
"what": "Hovering over element has unexpected effects",
"ordinalSeverity": 3,
"tagName": "LI",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet JoeTV"
},
{
"ruleID": "hover",
"what": "Hovering over element has unexpected effects",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "hover",
"what": "Link or button makes the hovering mouse cursor nonstandard",
"ordinalSeverity": 2,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}i"
},
{
"ruleID": "hover",
"what": "List item changes when hovered over",
"ordinalSeverity": 2,
"tagName": "LI",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
}
]
},
"labClash": {
"what": "labeling inconsistencies",
"data": {
"totals": {
"mislabeled": 0,
"unlabeled": 10,
"wellLabeled": 3
},
"items": {
"mislabeled": [],
"unlabeled": [
{
"index": 0,
"tagName": "INPUT",
"type": "text",
"texts": {}
},
{
"index": 1,
"tagName": "INPUT",
"type": "text",
"texts": {}
},
{
"index": 2,
"tagName": "INPUT",
"type": "email",
"texts": {}
},
{
"index": 3,
"tagName": "INPUT",
"type": "text",
"texts": {}
},
{
"index": 4,
"tagName": "INPUT",
"type": "text",
"texts": {}
},
{
"index": 6,
"tagName": "INPUT",
"type": "text",
"texts": {}
},
{
"index": 7,
"tagName": "INPUT",
"type": "text",
"texts": {}
},
{
"index": 8,
"tagName": "INPUT",
"type": "email",
"texts": {}
},
{
"index": 9,
"tagName": "INPUT",
"type": "text",
"texts": {}
},
{
"index": 11,
"tagName": "INPUT",
"type": "email",
"texts": {}
}
],
"wellLabeled": [
{
"index": 5,
"tagName": "BUTTON",
"type": "submit",
"texts": {
"content": "SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!win"
}
},
{
"index": 10,
"tagName": "BUTTON",
"type": "submit",
"texts": {
"content": "Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}i"
}
},
{
"index": 12,
"tagName": "BUTTON",
"type": "submit",
"texts": {
"content": "SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!win"
}
}
]
}
},
"totals": [
0,
0,
0,
10
],
"standardInstances": [
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
}
]
},
"linkTo": {
"what": "links without destinations",
"data": {
"total": 0,
"items": []
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"linkUl": {
"what": "missing underlines on inline links",
"data": {
"totals": {
"links": 45,
"adjacent": {
"total": 45,
"underlined": 1,
"underlinedPercent": 2
}
},
"items": {
"underlined": [
{
"id": "",
"text": "Close menu"
}
],
"notUnderlined": [
{
"id": "",
"text": "Main Menu"
},
{
"id": "",
"text": "Home"
},
{
"id": "",
"text": "Meet Joe"
},
{
"id": "",
"text": "Toggle submenu"
},
{
"id": "",
"text": "TV"
},
{
"id": "",
"text": "News"
},
{
"id": "",
"text": "AD5"
},
{
"id": "",
"text": "Issues"
},
{
"id": "",
"text": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id"
},
{
"id": "",
"text": "Home"
},
{
"id": "",
"text": "Meet Joe"
},
{
"id": "",
"text": "TV"
},
{
"id": "",
"text": "News"
},
{
"id": "",
"text": "AD5"
},
{
"id": "",
"text": "Issues"
},
{
"id": "",
"text": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\"><span"
},
{
"id": "",
"text": "HOME"
},
{
"id": "",
"text": "DONATE"
},
{
"id": "",
"text": "$5"
},
{
"id": "",
"text": "$10"
},
{
"id": "",
"text": "$25"
},
{
"id": "",
"text": "OTHER"
},
{
"id": "",
"text": "$5"
},
{
"id": "",
"text": "$10"
},
{
"id": "",
"text": "$25"
},
{
"id": "",
"text": "$50"
},
{
"id": "",
"text": "$75"
},
{
"id": "",
"text": "OTHER"
},
{
"id": "",
"text": "Learn More"
},
{
"id": "",
"text": "Home"
},
{
"id": "",
"text": "Meet Joe"
},
{
"id": "",
"text": "TV"
},
{
"id": "",
"text": "News"
},
{
"id": "",
"text": "AD5"
},
{
"id": "",
"text": "Issues"
},
{
"id": "",
"text": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\""
},
{
"id": "",
"text": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-"
},
{
"id": "",
"text": "HOME"
},
{
"id": "",
"text": "MEET JOE"
},
{
"id": "",
"text": "NEWS"
},
{
"id": "",
"text": "AD5"
},
{
"id": "",
"text": "ENDORSEMENTS"
},
{
"id": "",
"text": "YARD SIGNS"
},
{
"id": "",
"text": "VOLUNTEER"
}
]
}
},
"totals": [
0,
44,
0,
0
],
"standardInstances": [
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Main Menu"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Home"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Toggle submenu"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Issues"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Home"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Issues"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\"><span"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "HOME"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "DONATE"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$10"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$25"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "OTHER"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$10"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$25"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$50"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$75"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "OTHER"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Learn More"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Home"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Issues"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\""
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "HOME"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "MEET JOE"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "NEWS"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "ENDORSEMENTS"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "YARD SIGNS"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "VOLUNTEER"
}
]
},
"menuNav": {
"what": "nonstandard keyboard navigation between focusable menu items",
"data": {
"totals": {
"navigations": {
"all": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"specific": {
"tab": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"left": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"right": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"up": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"down": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"home": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"end": {
"total": 0,
"correct": 0,
"incorrect": 0
}
}
},
"menuItems": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"menus": {
"total": 0,
"correct": 0,
"incorrect": 0
}
},
"menuItems": {
"incorrect": [],
"correct": []
}
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"miniText": {
"what": "text smaller than 11 pixels",
"data": {
"total": 0,
"items": []
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"nonTable": {
"what": "table elements used for layout",
"data": {
"total": 0,
"items": []
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"radioSet": {
"what": "radio buttons not grouped into standard field sets",
"data": {
"totals": {
"total": 0,
"inSet": 0,
"percent": "N.A."
},
"items": {
"inSet": [],
"notInSet": []
}
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"role": {
"what": "invalid and native-replacing explicit roles",
"data": {
"roleElements": 8,
"badRoleElements": 0,
"redundantRoleElements": 0,
"tagNames": {}
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"styleDiff": {
"what": "style inconsistencies",
"data": {
"mainStyles": [
"fontStyle",
"fontWeight",
"opacity",
"textDecorationLine",
"textDecorationStyle",
"textDecorationThickness"
],
"buttonStyles": [
"borderStyle",
"borderWidth",
"height",
"lineHeight",
"maxHeight",
"maxWidth",
"minHeight",
"minWidth",
"outlineOffset",
"outlineStyle",
"outlineWidth"
],
"headingStyles": [
"color",
"fontSize"
],
"listLinkStyles": [
"color",
"fontSize",
"lineHeight"
],
"totals": {
"button": {
"total": 3
},
"adjacentLink": {
"total": 45,
"subtotals": [
24,
11,
5,
4,
1
]
}
},
"items": {
"adjacentLink": {
"fontWeight": {
"200": [
"Home",
"Meet Joe",
"News",
"AD5",
"Issues"
],
"400": [
"<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id",
"<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\"><span",
"<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\"",
"<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-",
"Close menu"
],
"700": [
"Main Menu",
"Home",
"Meet Joe",
"Toggle submenu",
"TV",
"News",
"AD5",
"Issues",
"Home",
"Meet Joe",
"TV",
"News",
"AD5",
"Issues",
"HOME",
"DONATE",
"TV",
"HOME",
"MEET JOE",
"NEWS",
"AD5",
"ENDORSEMENTS",
"YARD SIGNS",
"VOLUNTEER"
],
"900": [
"$5",
"$10",
"$25",
"OTHER",
"$5",
"$10",
"$25",
"$50",
"$75",
"OTHER",
"Learn More"
]
},
"textDecorationLine": {
"none": [
"Main Menu",
"Home",
"Meet Joe",
"Toggle submenu",
"TV",
"News",
"AD5",
"Issues",
"<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id",
"Home",
"Meet Joe",
"TV",
"News",
"AD5",
"Issues",
"<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\"><span",
"HOME",
"DONATE",
"$5",
"$10",
"$25",
"OTHER",
"$5",
"$10",
"$25",
"$50",
"$75",
"OTHER",
"Learn More",
"Home",
"Meet Joe",
"TV",
"News",
"AD5",
"Issues",
"<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\"",
"<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-",
"HOME",
"MEET JOE",
"NEWS",
"AD5",
"ENDORSEMENTS",
"YARD SIGNS",
"VOLUNTEER"
],
"underline": [
"Close menu"
]
}
}
}
},
"totals": [
4,
0,
0,
0
],
"standardInstances": [
{
"ruleID": "styleDiff",
"what": "In-line links have 5 different styles",
"count": 4,
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": ""
}
]
},
"tabNav": {
"what": "nonstandard keyboard navigation between elements with the tab role",
"data": {
"totals": {
"navigations": {
"all": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"specific": {
"tab": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"left": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"right": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"up": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"down": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"home": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"end": {
"total": 0,
"correct": 0,
"incorrect": 0
}
}
},
"tabElements": {
"total": 0,
"correct": 0,
"incorrect": 0
},
"tabLists": {
"total": 0,
"correct": 0,
"incorrect": 0
}
},
"tabElements": {
"incorrect": [],
"correct": []
}
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"titledEl": {
"what": "title attributes on inappropriate elements",
"data": {
"total": 0,
"items": []
},
"totals": [
0,
0,
0,
0
],
"standardInstances": []
},
"zIndex": {
"what": "non-default Z indexes",
"data": {
"totals": {
"total": 12,
"tagNames": {
"NAV": 1,
"DIV": 9,
"UL": 2
}
},
"items": [
{
"tagName": "NAV",
"id": "asmnvqfvmmootnluikvnozrkjelxspuhkucy",
"text": "Main MenuHomeMeet JoeToggle submenuTVNewsAD5Issues"
},
{
"tagName": "DIV",
"id": "mm-1",
"text": "Main MenuHomeMeet JoeToggle submenuTVNewsAD5Issues"
},
{
"tagName": "DIV",
"id": "",
"text": "Main Menu"
},
{
"tagName": "DIV",
"id": "mm-2",
"text": "TV"
},
{
"tagName": "DIV",
"id": "",
"text": "HomeMeet JoeTVNewsAD5Issues HOMEDONATE"
},
{
"tagName": "UL",
"id": "",
"text": "TV"
},
{
"tagName": "DIV",
"id": "wziehoicgkyratljhitjiidxmxjsagxhbsyb",
"text": "HOME"
},
{
"tagName": "DIV",
"id": "",
"text": "<div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/"
},
{
"tagName": "UL",
"id": "",
"text": "TV"
},
{
"tagName": "DIV",
"id": "",
"text": "Close menu"
},
{
"tagName": "DIV",
"id": "gfvfkzeiseiarwaanpeufzkocrfwprktavbj",
"text": "HOMEMEET JOENEWSAD5ENDORSEMENTSYARD SIGNSVOLUNTEER"
},
{
"tagName": "DIV",
"id": "",
"text": "<div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/"
}
]
},
"totals": [
12,
0,
0,
0
],
"standardInstances": [
{
"ruleID": "zIndex",
"what": "NAV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "NAV",
"id": "asmnvqfvmmootnluikvnozrkjelxspuhkucy",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Main MenuHomeMeet JoeToggle submenuTVNewsAD5Issues"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "mm-1",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Main MenuHomeMeet JoeToggle submenuTVNewsAD5Issues"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Main Menu"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "mm-2",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "HomeMeet JoeTVNewsAD5Issues HOMEDONATE"
},
{
"ruleID": "zIndex",
"what": "UL element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "wziehoicgkyratljhitjiidxmxjsagxhbsyb",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "HOME"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/"
},
{
"ruleID": "zIndex",
"what": "UL element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Close menu"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "gfvfkzeiseiarwaanpeufzkocrfwprktavbj",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "HOMEMEET JOENEWSAD5ENDORSEMENTSYARD SIGNSVOLUNTEER"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/"
}
]
}
},
"success": true
},
"standardResult": {
"totals": [
17,
51,
6,
48
],
"instances": [
{
"ruleID": "autocomplete",
"what": "Input is missing the required autocomplete attribute with value email",
"ordinalSeverity": 2,
"tagName": "INPUT",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx"
},
{
"ruleID": "autocomplete",
"what": "Input is missing the required autocomplete attribute with value email",
"ordinalSeverity": 2,
"tagName": "INPUT",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "#mgyugaeqkddylcikxicljnzwriqlzqyqgmnp"
},
{
"ruleID": "autocomplete",
"what": "Input is missing the required autocomplete attribute with value email",
"ordinalSeverity": 2,
"tagName": "INPUT",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "#chxlcwfzdkkzydlwngiklgablxhogbjfyjxn"
},
{
"ruleID": "bulk",
"what": "Page contains a large number of visible elements",
"count": 1,
"ordinalSeverity": 0,
"tagName": "HTML",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": ""
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Home"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Issues"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "DONATE"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$5"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$10"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$25"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$50"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$75"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "OTHER"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"jzrufgnrfzecnjmtttonuyghestufadxldym\" name=\"esdduiuzvslnnwyiwusamahcwtrnubyds"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"mclycssgwgofzkypsbsvkaswqtjdgpvowhhz\" name=\"rzfsrryoylspdpgnjcauhxjxffgiejlom"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"email\" id=\"olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx\" name=\"rbslawclytxmifhdvpuogfzlhpvddsiv"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"oijylgskfpupythmpgcgqnojnxwotrblubel\" name=\"uffubxyvtwxroutxldwpvcfdadmjaafns"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"cbowzefbgrpgocofetojkemunbeanmiuuxiw\" name=\"fmcghltvlkqyjhjgrcktbmjlastkbvpbq"
},
{
"ruleID": "focInd",
"what": "BUTTON element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!win"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Learn More"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv\" name=\"qpbhlocavlokobixymvtnwhjbflfnfpdh"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"xigbfawqysbbpzwgipmotfehpriwmghoorlv\" name=\"qmyycztxmfzpgaxxbnusqhohalacnwlvl"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"email\" id=\"mgyugaeqkddylcikxicljnzwriqlzqyqgmnp\" name=\"iqchbvqbkypqpxzphsgxbujqiwracjpi"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"text\" id=\"xzxcqjsxrqskvorhhphpxokryranycntgjrl\" name=\"oluhpiqjxgvcswhkqpthmlaapwamcnuwp"
},
{
"ruleID": "focInd",
"what": "BUTTON element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}i"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Home"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Issues"
},
{
"ruleID": "focInd",
"what": "INPUT element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<input type=\"email\" id=\"chxlcwfzdkkzydlwngiklgablxhogbjfyjxn\" name=\"zvaayiytjvbukklqiwsmdplxegznzybx"
},
{
"ruleID": "focInd",
"what": "BUTTON element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "SUBMIT !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}if(!win"
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\""
},
{
"ruleID": "focInd",
"what": "A element has no focus indicator",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-"
},
{
"ruleID": "focOp",
"complaint": "DIV element is operable but not focusable",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-popup2__close\" style=\"cursor: default;\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns"
},
{
"ruleID": "focOp",
"complaint": "DIV element is operable but not focusable",
"ordinalSeverity": 3,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-popup2__close\" style=\"cursor: default;\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns"
},
{
"ruleID": "hover",
"what": "Hovering over element has unexpected effects",
"ordinalSeverity": 3,
"tagName": "LI",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet JoeTV"
},
{
"ruleID": "hover",
"what": "Hovering over element has unexpected effects",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "hover",
"what": "Link or button makes the hovering mouse cursor nonstandard",
"ordinalSeverity": 2,
"tagName": "BUTTON",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Endorse Joe! !function(){function t(t){this.element=t,this.animationId,this.start=null,this.init()}i"
},
{
"ruleID": "hover",
"what": "List item changes when hovered over",
"ordinalSeverity": 2,
"tagName": "LI",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "labClash",
"what": "Element INPUT is unlabeled",
"ordinalSeverity": 3,
"tagName": "INPUT",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "INPUT: "
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Main Menu"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Home"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Toggle submenu"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Issues"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://joepatterson.com/\" data-brz-link-type=\"external\" id=\"\" data-custom-id"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Home"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Issues"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"#hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" data-brz-link-type=\"popup\" id=\"\"><span"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "HOME"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "DONATE"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$10"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$25"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "OTHER"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$10"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$25"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$50"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "$75"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "OTHER"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Learn More"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Home"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Meet Joe"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "News"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Issues"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://www.facebook.com/PattersonForAssembly\" target=\"_blank\" rel=\"noopener\""
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<a class=\"brz-a\" href=\"https://twitter.com/Patterdude\" target=\"_blank\" rel=\"noopener\" data-brz-link-"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "HOME"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "MEET JOE"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "NEWS"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "AD5"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "ENDORSEMENTS"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "YARD SIGNS"
},
{
"ruleID": "linkUl",
"what": "Link is inline but has no underline",
"ordinalSeverity": 1,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "VOLUNTEER"
},
{
"ruleID": "styleDiff",
"what": "In-line links have 5 different styles",
"count": 4,
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": ""
},
{
"ruleID": "zIndex",
"what": "NAV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "NAV",
"id": "asmnvqfvmmootnluikvnozrkjelxspuhkucy",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Main MenuHomeMeet JoeToggle submenuTVNewsAD5Issues"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "mm-1",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Main MenuHomeMeet JoeToggle submenuTVNewsAD5Issues"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Main Menu"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "mm-2",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "HomeMeet JoeTVNewsAD5Issues HOMEDONATE"
},
{
"ruleID": "zIndex",
"what": "UL element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "wziehoicgkyratljhitjiidxmxjsagxhbsyb",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "HOME"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/"
},
{
"ruleID": "zIndex",
"what": "UL element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "UL",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "TV"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "Close menu"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "gfvfkzeiseiarwaanpeufzkocrfwprktavbj",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "HOMEMEET JOENEWSAD5ENDORSEMENTSYARD SIGNSVOLUNTEER"
},
{
"ruleID": "zIndex",
"what": "DIV element has a non-default Z index",
"ordinalSeverity": 0,
"tagName": "DIV",
"id": "",
"location": {
"doc": "",
"type": "",
"spec": ""
},
"excerpt": "<div class=\"brz-popup2__close\"><svg viewBox=\"0 0 16 16\" version=\"1.1\" xmlns=\"http://www.w3.org/2000/"
}
]
},
"endTime": 1687099569878
},
{
"type": "test",
"which": "wave",
"reportType": 4,
"startTime": 1687099569878,
"url": "https://joepatterson.com/",
"what": "WAVE",
"result": {
"status": {
"success": true,
"httpstatuscode": 200
},
"statistics": {
"pagetitle": "Joe Patterson",
"pageurl": "https://joepatterson.com/",
"time": 2.81,
"creditsremaining": 1128,
"allitemcount": 82,
"totalelements": 652,
"waveurl": "http://wave.webaim.org/report?url=https://joepatterson.com/"
},
"categories": {
"error": {
"description": "Errors",
"count": 15,
"items": {
"alt_link_missing": {
"id": "alt_link_missing",
"description": "Linked image missing alternative text",
"count": 1,
"selectors": [
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > A:first-child > PICTURE:first-child > IMG:first-child"
],
"wcag": [
{
"name": "1.1.1 Non-text Content (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc1.1.1"
},
{
"name": "2.4.4 Link Purpose (In Context) (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc2.4.4"
}
]
},
"alt_spacer_missing": {
"id": "alt_spacer_missing",
"description": "Spacer image missing alternative text",
"count": 1,
"selectors": [
"HTML > HEAD:first-child + BODY > IMG:first-child"
],
"wcag": [
{
"name": "1.1.1 Non-text Content (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc1.1.1"
}
]
},
"label_missing": {
"id": "label_missing",
"description": "Missing form label",
"count": 10,
"selectors": [
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child > INPUT#jzrufgnrfzecnjmtttonuyghestufadxldym",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV > INPUT#mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV + DIV > INPUT#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV + DIV + DIV > INPUT#oijylgskfpupythmpgcgqnojnxwotrblubel",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV + DIV + DIV + DIV > INPUT#cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child > INPUT#ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV > INPUT#xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV + DIV > INPUT#mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV + DIV + DIV > INPUT#xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child > INPUT#chxlcwfzdkkzydlwngiklgablxhogbjfyjxn"
],
"wcag": [
{
"name": "1.1.1 Non-text Content (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc1.1.1"
},
{
"name": "1.3.1 Info and Relationships (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc1.3.1"
},
{
"name": "2.4.6 Headings and Labels (Level AA)",
"link": "https://webaim.org/standards/wcag/checklist#sc2.4.6"
},
{
"name": "3.3.2 Labels or Instructions (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc3.3.2"
}
]
},
"link_empty": {
"id": "link_empty",
"description": "Empty link",
"count": 3,
"selectors": [
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > A:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV#gucekfcwzkwvwbcfqjgrflyvigkonlxuvqdd > DIV:first-child > A:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV#nzkalizvyqxpxwhmghgfojzckegcabnhnsiw > DIV:first-child > A:first-child"
],
"wcag": [
{
"name": "2.4.4 Link Purpose (In Context) (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc2.4.4"
}
]
}
}
},
"contrast": {
"description": "Contrast Errors",
"count": 19,
"items": {
"contrast": {
"id": "contrast",
"description": "Very low contrast",
"count": 19,
"selectors": [
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child > A:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI > A:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI > A:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI + LI > A:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI + LI + LI > A:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > P:first-child > STRONG:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > STRONG:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child > A:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI > A:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI > A:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI + LI > A:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI + LI + LI > A:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV > BUTTON:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child + SPAN",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child + SPAN + SPAN"
],
"contrastdata": [
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
true
],
[
1,
"#ffffff",
"#ffffff",
false
],
[
1,
"#ffffff",
"#ffffff",
false
],
[
1,
"#ffffff",
"#ffffff",
false
],
[
1,
"#ffffff",
"#ffffff",
false
]
],
"wcag": [
{
"name": "1.4.3 Contrast (Minimum) (Level AA)",
"link": "https://webaim.org/standards/wcag/checklist#sc1.4.3"
}
]
}
}
},
"alert": {
"description": "Alerts",
"count": 25,
"items": {
"heading_missing": {
"id": "heading_missing",
"description": "No heading structure",
"count": 1,
"selectors": [
false
],
"wcag": [
{
"name": "1.3.1 Info and Relationships (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc1.3.1"
},
{
"name": "2.4.6 Headings and Labels (Level AA)",
"link": "https://webaim.org/standards/wcag/checklist#sc2.4.6"
}
]
},
"heading_possible": {
"id": "heading_possible",
"description": "Possible heading",
"count": 17,
"selectors": [
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV#wziehoicgkyratljhitjiidxmxjsagxhbsyb > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child + P + P",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV + DIV + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV + DIV + DIV + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child"
],
"wcag": [
{
"name": "1.3.1 Info and Relationships (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc1.3.1"
},
{
"name": "2.4.1 Bypass Blocks (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc2.4.1"
},
{
"name": "2.4.6 Headings and Labels (Level AA)",
"link": "https://webaim.org/standards/wcag/checklist#sc2.4.6"
}
]
},
"link_internal_broken": {
"id": "link_internal_broken",
"description": "Broken same-page link",
"count": 1,
"selectors": [
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > A:first-child"
],
"wcag": [
{
"name": "2.1.1 Keyboard (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc2.1.1"
}
]
},
"link_redundant": {
"id": "link_redundant",
"description": "Redundant link",
"count": 2,
"selectors": [
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child > A:first-child",
"HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV + DIV + DIV + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child > A:first-child"
],
"wcag": [
{
"name": "2.4.4 Link Purpose (In Context) (Level A)",
"link": "https://webaim.org/standards/wcag/checklist#sc2.4.4"
}
]
},
"noscript": {
"id": "noscript",
"description": "Noscript element",
"count": 2,
"selectors": [
"HTML > HEAD:first-child > META:first-child + LINK + LINK + TITLE + META + META + META + LINK + META + META + META + META + META + META + META + META + META + META + META + META + META + META + META + META + SCRIPT + SCRIPT + SCRIPT + SCRIPT + LINK + LINK + LINK + SCRIPT + SCRIPT + STYLE + LINK + STYLE + LINK + STYLE + LINK + LINK + LINK + LINK + STYLE + SCRIPT + SCRIPT + SCRIPT + LINK + LINK + LINK + LINK + META + LINK + LINK + LINK + META + SCRIPT + NOSCRIPT",
"HTML > HEAD:first-child + BODY > IMG:first-child + SCRIPT + SCRIPT + SCRIPT + NOSCRIPT"
],
"wcag": []
},
"text_justified": {
"id": "text_justified",
"description": "Justified text",
"count": 2,
"selectors": [
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child",
"HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child + P"
],
"wcag": []
}
}
}
},
"success": true
},
"standardResult": {
"totals": [
25,
0,
0,
34
],
"instances": [
{
"ruleID": "alt_link_missing",
"what": "Linked image missing alternative text",
"ordinalSeverity": 3,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > A:first-child > PICTURE:first-child > IMG:first-child"
},
"excerpt": ""
},
{
"ruleID": "alt_spacer_missing",
"what": "Spacer image missing alternative text",
"ordinalSeverity": 3,
"tagName": "IMG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > IMG:first-child"
},
"excerpt": ""
},
{
"ruleID": "label_missing",
"what": "Missing form label",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "jzrufgnrfzecnjmtttonuyghestufadxldym",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child > INPUT#jzrufgnrfzecnjmtttonuyghestufadxldym"
},
"excerpt": ""
},
{
"ruleID": "label_missing",
"what": "Missing form label",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mclycssgwgofzkypsbsvkaswqtjdgpvowhhz",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV > INPUT#mclycssgwgofzkypsbsvkaswqtjdgpvowhhz"
},
"excerpt": ""
},
{
"ruleID": "label_missing",
"what": "Missing form label",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV + DIV > INPUT#olqhxwzdhjchzxzuqlktxcdcykoapmlcrrhx"
},
"excerpt": ""
},
{
"ruleID": "label_missing",
"what": "Missing form label",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "oijylgskfpupythmpgcgqnojnxwotrblubel",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV + DIV + DIV > INPUT#oijylgskfpupythmpgcgqnojnxwotrblubel"
},
"excerpt": ""
},
{
"ruleID": "label_missing",
"what": "Missing form label",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "cbowzefbgrpgocofetojkemunbeanmiuuxiw",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV + DIV + DIV + DIV > INPUT#cbowzefbgrpgocofetojkemunbeanmiuuxiw"
},
"excerpt": ""
},
{
"ruleID": "label_missing",
"what": "Missing form label",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child > INPUT#ixxvalgeezkcjipkjoqbkqdxkjbajhxarobv"
},
"excerpt": ""
},
{
"ruleID": "label_missing",
"what": "Missing form label",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xigbfawqysbbpzwgipmotfehpriwmghoorlv",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV > INPUT#xigbfawqysbbpzwgipmotfehpriwmghoorlv"
},
"excerpt": ""
},
{
"ruleID": "label_missing",
"what": "Missing form label",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "mgyugaeqkddylcikxicljnzwriqlzqyqgmnp",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV + DIV > INPUT#mgyugaeqkddylcikxicljnzwriqlzqyqgmnp"
},
"excerpt": ""
},
{
"ruleID": "label_missing",
"what": "Missing form label",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "xzxcqjsxrqskvorhhphpxokryranycntgjrl",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV + DIV + DIV > INPUT#xzxcqjsxrqskvorhhphpxokryranycntgjrl"
},
"excerpt": ""
},
{
"ruleID": "label_missing",
"what": "Missing form label",
"ordinalSeverity": 3,
"tagName": "INPUT",
"id": "chxlcwfzdkkzydlwngiklgablxhogbjfyjxn",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child > INPUT#chxlcwfzdkkzydlwngiklgablxhogbjfyjxn"
},
"excerpt": ""
},
{
"ruleID": "link_empty",
"what": "Empty link",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > A:first-child"
},
"excerpt": ""
},
{
"ruleID": "link_empty",
"what": "Empty link",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV#gucekfcwzkwvwbcfqjgrflyvigkonlxuvqdd > DIV:first-child > A:first-child"
},
"excerpt": ""
},
{
"ruleID": "link_empty",
"what": "Empty link",
"ordinalSeverity": 3,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV#nzkalizvyqxpxwhmghgfojzckegcabnhnsiw > DIV:first-child > A:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child > A:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI > A:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI > A:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI + LI > A:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI + LI + LI > A:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > P:first-child > STRONG:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "STRONG",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > STRONG:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child > A:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI > A:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI > A:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI + LI > A:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child + LI + LI + LI + LI > A:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > FORM:first-child > DIV:first-child + DIV > BUTTON:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child + SPAN"
},
"excerpt": ""
},
{
"ruleID": "contrast",
"what": "Very low contrast",
"ordinalSeverity": 3,
"tagName": "SPAN",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > FOOTER#ekgwjnuvotyydehtoshkvsgqrplvompyerpl > DIV:first-child + DIV > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child > SPAN:first-child + SPAN + SPAN"
},
"excerpt": ""
},
{
"ruleID": "heading_missing",
"what": "No heading structure",
"ordinalSeverity": 0,
"tagName": "",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": false
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV#wziehoicgkyratljhitjiidxmxjsagxhbsyb > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child + P + P"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#tsnyxhxvoacqukmhcoecuaytkyajlpzvkjcq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#swrzaymrritriifaxncitleeesxqtlxbwqki > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#nrsyodnwsaxmyzhrmgvvhkwqghotdvwhsfag > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#fetuuznzogsnzygxryipwojeykneayofedzq > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV + DIV + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "heading_possible",
"what": "Possible heading",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV + DIV + DIV + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "link_internal_broken",
"what": "Broken same-page link",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > A:first-child"
},
"excerpt": ""
},
{
"ruleID": "link_redundant",
"what": "Redundant link",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#boroayesxcxncbznxtpzjtasgpneccwhwsyu > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > NAV:first-child > UL:first-child > LI:first-child > A:first-child"
},
"excerpt": ""
},
{
"ruleID": "link_redundant",
"what": "Redundant link",
"ordinalSeverity": 0,
"tagName": "A",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#gfvfkzeiseiarwaanpeufzkocrfwprktavbj > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV + DIV + DIV + DIV + DIV + DIV > DIV:first-child > DIV:first-child > P:first-child > A:first-child"
},
"excerpt": ""
},
{
"ruleID": "noscript",
"what": "Noscript element",
"ordinalSeverity": 0,
"tagName": "NOSCRIPT",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child > META:first-child + LINK + LINK + TITLE + META + META + META + LINK + META + META + META + META + META + META + META + META + META + META + META + META + META + META + META + META + SCRIPT + SCRIPT + SCRIPT + SCRIPT + LINK + LINK + LINK + SCRIPT + SCRIPT + STYLE + LINK + STYLE + LINK + STYLE + LINK + LINK + LINK + LINK + STYLE + SCRIPT + SCRIPT + SCRIPT + LINK + LINK + LINK + LINK + META + LINK + LINK + LINK + META + SCRIPT + NOSCRIPT"
},
"excerpt": ""
},
{
"ruleID": "noscript",
"what": "Noscript element",
"ordinalSeverity": 0,
"tagName": "NOSCRIPT",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > IMG:first-child + SCRIPT + SCRIPT + SCRIPT + NOSCRIPT"
},
"excerpt": ""
},
{
"ruleID": "text_justified",
"what": "Justified text",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child"
},
"excerpt": ""
},
{
"ruleID": "text_justified",
"what": "Justified text",
"ordinalSeverity": 0,
"tagName": "P",
"id": "",
"location": {
"doc": "dom",
"type": "selector",
"spec": "HTML > HEAD:first-child + BODY > DIV#mm-0 > SECTION#wqmshehelroxhxmgmkivkdonmdztoiazluxr > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child + DIV > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > DIV:first-child > P:first-child + P"
},
"excerpt": ""
}
]
},
"endTime": 1687099573325
}
],
"sources": {
"script": "ts27",
"batch": "caassy",
"target": {
"id": "caAD5-c",
"which": "https://joepatterson.com/",
"what": "Candidate Joe Patterson (R)"
},
"requester": "pool@jpdev.pro"
},
"creationTime": "2023-06-18T02:07:06",
"timeStamp": "18ixx",
"jobData": {
"startTime": "2023-06-18T14:44:48",
"endTime": "2023-06-18T14:46:13",
"elapsedSeconds": 85,
"visitLatency": 7,
"logCount": 40,
"logSize": 8457,
"errorLogCount": 0,
"errorLogSize": 0,
"prohibitedCount": 0,
"visitRejectionCount": 0,
"aborted": false,
"abortedAct": null,
"presses": 0,
"amountRead": 0,
"testTimes": [
[
"testaro",
39
],
[
"testaro",
13
],
[
"alfa",
6
],
[
"ibm",
3
],
[
"qualWeb",
3
],
[
"wave",
3
],
[
"nuVal",
2
],
[
"axe",
1
],
[
"continuum",
0
],
[
"htmlcs",
0
],
[
"tenon",
0
]
]
},
"score": {
"scoreProcID": "tsp27",
"summary": {
"total": 1696,
"issue": 1456,
"tool": 219,
"prevention": 0,
"log": 21,
"latency": 0
},
"details": {
"severity": {
"total": [
145,
150,
150,
324
],
"byTool": {
"testaro": [
17,
51,
6,
48
],
"alfa": [
45,
0,
0,
42
],
"axe": [
13,
11,
25,
5
],
"continuum": [
0,
0,
0,
29
],
"htmlcs": [
22,
0,
0,
39
],
"ibm": [
0,
5,
0,
43
],
"nuVal": [
5,
0,
24,
2
],
"qualWeb": [
18,
83,
80,
34
],
"tenon": [
0,
0,
15,
48
],
"wave": [
25,
0,
0,
34
]
}
},
"prevention": {},
"issue": {
"linkNoText": {
"score": 16,
"maxCount": 4,
"weight": 4,
"tools": {
"alfa": {
"r11": {
"quality": 1,
"what": "Link has no accessible name",
"complaints": {
"countTotal": 3,
"texts": [
"Links have an accessible name"
]
}
}
},
"axe": {
"link-name": {
"quality": 1,
"what": "Link has no discernible text",
"complaints": {
"countTotal": 3,
"texts": [
"Links must have discernible text; Element does not have text that is visible to screen readers; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute"
]
}
}
},
"continuum": {
"237": {
"quality": 1,
"what": "a element has no machanism allowing an accessible name value to be calculated",
"complaints": {
"countTotal": 3,
"texts": [
"This A element does not have a mechanism that allows an accessible name value to be calculated"
]
}
}
},
"htmlcs": {
"AAA.4_1_2.H91.A.NoContent": {
"quality": 1,
"what": "Link has an href attribute but no text",
"complaints": {
"countTotal": 3,
"texts": [
"Anchor element found with a valid href attribute, but no link content has been supplied."
]
}
}
},
"ibm": {
"a_text_purpose": {
"quality": 1,
"what": "Hyperlink has no link text, label, or image with a text alternative",
"complaints": {
"countTotal": 4,
"texts": [
"Hyperlink has no link text, label or image with a text alternative"
]
}
}
},
"qualWeb": {
"QW-ACT-R12": {
"quality": 1,
"what": "Link has no accessible name",
"complaints": {
"countTotal": 3,
"texts": [
"This rule checks that each link has an accessible name."
]
}
},
"QW-WCAG-T21": {
"quality": 1,
"what": "Accessible name is not provided for an image which is the only content in a link",
"complaints": {
"countTotal": 1,
"texts": [
"This technique checks the text alternative of images which are the only content of a link"
]
}
}
},
"tenon": {
"57": {
"quality": 1,
"what": "Link has no text inside it",
"complaints": {
"countTotal": 4,
"texts": [
"This link has no text inside it."
]
}
}
},
"wave": {
"alt_link_missing": {
"quality": 1,
"what": "Linked image has no text alternative",
"complaints": {
"countTotal": 1,
"texts": [
"Linked image missing alternative text"
]
}
},
"link_empty": {
"quality": 1,
"what": "Link contains no text",
"complaints": {
"countTotal": 3,
"texts": [
"Empty link"
]
}
}
}
}
},
"imageNoText": {
"score": 12,
"maxCount": 3,
"weight": 4,
"tools": {
"alfa": {
"r2": {
"quality": 1,
"what": "Image has no accessible name",
"complaints": {
"countTotal": 1,
"texts": [
"Images have an accessible name"
]
}
}
},
"axe": {
"image-alt": {
"quality": 1,
"what": "Image has no text alternative",
"complaints": {
"countTotal": 1,
"texts": [
"Images must have alternate text; Element does not have an alt attribute; aria-label attribute does not exist or is empty; aria-labelledby attribute does not exist, references elements that do not exist or references elements that are empty; Element has no title attribute; Element's default semantics were not overridden with role=\"none\" or role=\"presentation\""
]
}
}
},
"continuum": {
"89": {
"quality": 1,
"what": "img element has no machanism allowing an accessible name to be calculated",
"complaints": {
"countTotal": 1,
"texts": [
"This img element does not have a mechanism that allows an accessible name value to be calculated"
]
}
}
},
"htmlcs": {
"AAA.1_1_1.H37": {
"quality": 1,
"what": "img element has no alt attribute",
"complaints": {
"countTotal": 1,
"texts": [
"Img element missing an alt attribute. Use the alt attribute to specify a short text alternative."
]
}
}
},
"ibm": {
"img_alt_valid": {
"quality": 1,
"what": "Image has neither an alt attribute nor an ARIA label or title",
"complaints": {
"countTotal": 1,
"texts": [
"The image has neither an alt atttribute nor an ARIA label or title"
]
}
}
},
"nuVal": {
"An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images.": {
"quality": 1,
"what": "img element has no alt attribute",
"complaints": {
"countTotal": 3,
"texts": [
"An img element must have an alt attribute, except under certain conditions. For details, consult guidance on providing text alternatives for images."
]
}
}
},
"qualWeb": {
"QW-ACT-R17": {
"quality": 1,
"what": "Image has no accessible name",
"complaints": {
"countTotal": 1,
"texts": [
"This rule checks that each image that is not marked as decorative, has an accessible name."
]
}
}
},
"wave": {
"alt_spacer_missing": {
"quality": 1,
"what": "Spacer image has no text alternative",
"complaints": {
"countTotal": 1,
"texts": [
"Spacer image missing alternative text"
]
}
}
}
}
},
"duplicateID": {
"score": 88,
"maxCount": 22,
"weight": 4,
"tools": {
"alfa": {
"r3": {
"quality": 1,
"what": "Element id attribute value is not unique",
"complaints": {
"countTotal": 6,
"texts": [
"id attributes have a unique value"
]
}
}
},
"axe": {
"duplicate-id": {
"quality": 1,
"what": "id attribute value is not unique",
"complaints": {
"countTotal": 2,
"texts": [
"id attribute value must be unique; Document has multiple static elements with the same id attribute: close-popup",
"id attribute value must be unique; Document has multiple static elements with the same id attribute: Line-2"
]
}
}
},
"continuum": {
"94": {
"quality": 1,
"what": "Element contains an id attribute set to a value that is not unique in the DOM",
"complaints": {
"countTotal": 6,
"texts": [
"This g has an id attribute of 'close-popup', which is not unique in the same DOM",
"This path has an id attribute of 'Line-2', which is not unique in the same DOM"
]
}
}
},
"htmlcs": {
"AAA.4_1_1.F77": {
"quality": 1,
"what": "Duplicate id attribute value",
"complaints": {
"countTotal": 3,
"texts": [
"Duplicate id attribute value \"close-popup\" found on the web page.",
"Duplicate id attribute value \"Line-2\" found on the web page."
]
}
}
},
"ibm": {
"element_id_unique": {
"quality": 1,
"what": "Element has an id attribute value that is already in use",
"complaints": {
"countTotal": 22,
"texts": [
"The <a> element has the id \"\" that is empty",
"The <div> element has the id \"\" that is empty"
]
}
}
},
"qualWeb": {
"QW-ACT-R18": {
"quality": 1,
"what": "id attribute value is not unique",
"complaints": {
"countTotal": 8,
"texts": [
"This rule checks that all id attribute values on a single page are unique."
]
}
}
}
}
},
"contentBeyondLandmarks": {
"score": 40,
"maxCount": 20,
"weight": 2,
"tools": {
"alfa": {
"r57": {
"quality": 1,
"what": "Perceivable text content is not included in any landmark",
"complaints": {
"countTotal": 20,
"texts": [
"Perceivable text content is included in a landmark"
]
}
}
},
"axe": {
"region": {
"quality": 1,
"what": "Some page content is not contained by landmarks",
"complaints": {
"countTotal": 20,
"texts": [
"All page content should be contained by landmarks; Some page content is not contained by landmarks"
]
}
}
},
"ibm": {
"aria_content_in_landmark": {
"quality": 1,
"what": "Content is not within a landmark element",
"complaints": {
"countTotal": 16,
"texts": [
"Content is not within a landmark element"
]
}
}
}
}
},
"noHeading": {
"score": 3,
"maxCount": 1,
"weight": 3,
"tools": {
"alfa": {
"r59": {
"quality": 1,
"what": "Document has no headings",
"complaints": {
"countTotal": 1,
"texts": [
"Documents have headings"
]
}
}
},
"wave": {
"heading_missing": {
"quality": 1,
"what": "Page has no headings",
"complaints": {
"countTotal": 1,
"texts": [
"No heading structure"
]
}
}
}
}
},
"focusIndication": {
"score": 136,
"maxCount": 34,
"weight": 4,
"tools": {
"alfa": {
"r65": {
"quality": 1,
"what": "Element in the sequential focus order has no visible focus",
"complaints": {
"countTotal": 34,
"texts": [
"Element in sequential focus order has visible focus"
]
}
}
},
"qualWeb": {
"QW-ACT-R62": {
"quality": 1,
"what": "Element in the sequential focus order has no visible focus",
"complaints": {
"countTotal": 34,
"texts": [
"This rule checks that each element in sequential focus order has some visible focus indication."
]
}
}
},
"testaro": {
"focInd": {
"quality": 1,
"what": "Focused element displays a nonstandard or no focus indicator",
"complaints": {
"countTotal": 34,
"texts": [
"A element has no focus indicator",
"INPUT element has no focus indicator",
"BUTTON element has no focus indicator"
]
}
}
}
}
},
"contrastAAA": {
"score": 12,
"maxCount": 12,
"weight": 1,
"tools": {
"alfa": {
"r66": {
"quality": 1,
"what": "Text contrast less than AAA requires",
"complaints": {
"countTotal": 6,
"texts": [
"Text outside widget has enhanced contrast"
]
}
}
},
"axe": {
"color-contrast-enhanced": {
"quality": 1,
"what": "Element has insufficient color contrast (Level AAA)",
"complaints": {
"countTotal": 1,
"texts": [
"Elements must meet enhanced color contrast ratio thresholds; Element has insufficient color contrast of 4.68 (foreground color: #ffffff, background color: #e1251b, font size: 11.3pt (15px), font weight: bold). Expected contrast ratio of 7:1"
]
}
}
},
"htmlcs": {
"AAA.1_4_6.G17.Fail": {
"quality": 1,
"what": "Text has insufficient contrast",
"complaints": {
"countTotal": 3,
"texts": [
"This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #595959.",
"This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 7:1, but text in this element has a contrast ratio of 4.69:1. Recommendation: change background to #b40900."
]
}
}
},
"qualWeb": {
"QW-ACT-R76": {
"quality": 1,
"what": "Text has less than the enhanced minimum contrast",
"complaints": {
"countTotal": 12,
"texts": [
"This rule checks that the highest possible contrast of every text character with its background meets the enhanced contrast requirement."
]
}
}
}
}
},
"textContrastAA": {
"score": 76,
"maxCount": 19,
"weight": 4,
"tools": {
"alfa": {
"r69": {
"quality": 1,
"what": "Text outside widget has subminimum contrast",
"complaints": {
"countTotal": 5,
"texts": [
"Text outside widget has minimum contrast"
]
}
}
},
"axe": {
"color-contrast": {
"quality": 1,
"what": "Element has insufficient color contrast",
"complaints": {
"countTotal": 11,
"texts": [
"Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined due to a background gradient",
"Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it partially overlaps other elements",
"Elements must meet minimum color contrast ratio thresholds; Element's background color could not be determined because it is overlapped by another element"
]
}
}
},
"htmlcs": {
"AAA.1_4_6.G18.Fail": {
"quality": 1,
"what": "Contrast between the text and its background is less than 4.5:1",
"complaints": {
"countTotal": 5,
"texts": [
"This element has insufficient contrast at this conformance level. Expected a contrast ratio of at least 4.5:1, but text in this element has a contrast ratio of 1:1. Recommendation: change text colour to #767676."
]
}
}
},
"qualWeb": {
"QW-ACT-R37": {
"quality": 1,
"what": "Text has less than the minimum contrast",
"complaints": {
"countTotal": 10,
"texts": [
"This rule checks that the highest possible contrast of every text character with its background meets the minimal contrast requirement."
]
}
}
},
"wave": {
"contrast": {
"quality": 1,
"what": "Very low contrast",
"complaints": {
"countTotal": 19,
"texts": [
"Very low contrast"
]
}
}
}
}
},
"justification": {
"score": 4,
"maxCount": 2,
"weight": 2,
"tools": {
"alfa": {
"r71": {
"quality": 1,
"what": "Paragraph text is fully justified",
"complaints": {
"countTotal": 1,
"texts": [
"Paragraphs of text are not justified"
]
}
}
},
"tenon": {
"36": {
"quality": 1,
"what": "Text is fully justified",
"complaints": {
"countTotal": 2,
"texts": [
"This text is justified."
]
}
}
},
"wave": {
"text_justified": {
"quality": 1,
"what": "Text is justified",
"complaints": {
"countTotal": 2,
"texts": [
"Justified text"
]
}
}
}
}
},
"leadingInsufficient": {
"score": 8,
"maxCount": 4,
"weight": 2,
"tools": {
"alfa": {
"r73": {
"quality": 1,
"what": "Paragraph of text has insufficient line height",
"complaints": {
"countTotal": 4,
"texts": [
"Paragraphs of text have sufficient line height"
]
}
}
}
}
},
"fontSizeAbsolute": {
"score": 100,
"maxCount": 50,
"weight": 2,
"tools": {
"alfa": {
"r74": {
"quality": 1,
"what": "Paragraph text has an absolute font size",
"complaints": {
"countTotal": 5,
"texts": [
"Paragraphs of text do not have font sizes defined in absolute units"
]
}
}
},
"qualWeb": {
"QW-WCAG-T28": {
"quality": 1,
"what": "Percent, em, or name is used for a font size",
"complaints": {
"countTotal": 50,
"texts": [
"This technique checks that all font-size attribute uses percent, em or names."
]
}
}
}
}
},
"repeatedContentRisk": {
"score": 9,
"maxCount": 9,
"weight": 1,
"tools": {
"alfa": {
"r87": {
"quality": 0.5,
"what": "First focusable element is not a link to the main content",
"complaints": {
"countTotal": 1,
"texts": [
"First focusable element is link to main content"
]
}
}
},
"qualWeb": {
"QW-ACT-R73": {
"quality": 1,
"what": "Block of repeated content is not collapsible",
"complaints": {
"countTotal": 1,
"texts": [
"This rule checks that repeated blocks of content are collapsible."
]
}
},
"QW-ACT-R74": {
"quality": 1,
"what": "Document has no instrument to move focus to non-repeated content",
"complaints": {
"countTotal": 1,
"texts": [
"This rule checks that there is an instrument to move focus to non-repeated content in the page."
]
}
},
"QW-WCAG-T23": {
"quality": 1,
"what": "No link at the top of the page that goes directly to the main content area",
"complaints": {
"countTotal": 1,
"texts": [
"The objective of this technique is to provide a mechanism to bypass blocks of material that are repeated on multiple Web pages by skipping directly to the main content of the Web page."
]
}
},
"QW-BP17": {
"quality": 1,
"what": "No link at the beginning of a block of repeated content goes to the end of the block",
"complaints": {
"countTotal": 6,
"texts": [
"The objective of this technique is to provide a mechanism to bypass a block of material by skipping to the end of the block."
]
}
}
}
}
},
"hiddenContentRisk": {
"score": 13,
"maxCount": 13,
"weight": 1,
"tools": {
"axe": {
"hidden-content": {
"quality": 1,
"what": "Some content is hidden and therefore may not be testable for accessibility",
"complaints": {
"countTotal": 13,
"texts": [
"Hidden content on the page should be analyzed; There is hidden content on the page that was not analyzed. You will need to trigger the display of this content in order to analyze it."
]
}
}
}
}
},
"mainNone": {
"score": 2,
"maxCount": 1,
"weight": 2,
"tools": {
"axe": {
"landmark-one-main": {
"quality": 1,
"what": "page has no main landmark",
"complaints": {
"countTotal": 1,
"texts": [
"Document should have one main landmark; Document does not have a main landmark"
]
}
}
},
"qualWeb": {
"QW-ACT-R63": {
"quality": 1,
"what": "Document has no landmark with non-repeated content",
"complaints": {
"countTotal": 1,
"texts": [
"This rule checks that each page has an element with a landmark semantic role starting with non-repeated content"
]
}
}
}
}
},
"landmarkConfusion": {
"score": 3,
"maxCount": 1,
"weight": 3,
"tools": {
"axe": {
"landmark-unique": {
"quality": 1,
"what": "Landmark has a role and an accessible name that are identical to another",
"complaints": {
"countTotal": 1,
"texts": [
"Ensures landmarks are unique; The landmark must have a unique aria-label, aria-labelledby, or title to make landmarks distinguishable"
]
}
}
}
}
},
"h1Missing": {
"score": 3,
"maxCount": 1,
"weight": 3,
"tools": {
"axe": {
"page-has-heading-one": {
"quality": 1,
"what": "Page contains no level-one heading",
"complaints": {
"countTotal": 1,
"texts": [
"Page should contain a level-one heading; Page must have a level-one heading"
]
}
}
}
}
},
"svgImageNoText": {
"score": 20,
"maxCount": 5,
"weight": 4,
"tools": {
"continuum": {
"123": {
"quality": 1,
"what": "svg element has no machanism allowing an accessible name to be calculated",
"complaints": {
"countTotal": 5,
"texts": [
"This svg element does not have a mechanism that allows an accessible name value to be calculated"
]
}
}
}
}
},
"navConfusion": {
"score": 6,
"maxCount": 2,
"weight": 3,
"tools": {
"continuum": {
"531": {
"quality": 1,
"what": "nav element has an accessible name that is non-unique among the nav elements",
"complaints": {
"countTotal": 2,
"texts": [
"This nav does not have a unique accessible name as required when two or more nav elements are present"
]
}
}
}
}
},
"navNoText": {
"score": 6,
"maxCount": 2,
"weight": 3,
"tools": {
"continuum": {
"533": {
"quality": 1,
"what": "nav element is not the only nav element but has no accessible name",
"complaints": {
"countTotal": 2,
"texts": [
"This nav does not have an accessible name as required when two or more nav elements are present"
]
}
}
}
}
},
"inputOnlyPlaceholder": {
"score": 30,
"maxCount": 10,
"weight": 3,
"tools": {
"continuum": {
"863": {
"quality": 1,
"what": "input has an accessible name that depends on a placeholder",
"complaints": {
"countTotal": 10,
"texts": [
"This input should not rely on text in the placeholder attribute for an accessible name"
]
}
}
}
}
},
"decorativeImageRisk": {
"score": 3,
"maxCount": 3,
"weight": 1,
"tools": {
"htmlcs": {
"AAA.1_1_1.H67.2": {
"quality": 1,
"what": "Image marked as decorative may be informative",
"complaints": {
"countTotal": 3,
"texts": [
"Img element is marked so that it is ignored by Assistive Technology."
]
}
}
}
}
},
"pseudoHeadingRisk": {
"score": 17,
"maxCount": 17,
"weight": 1,
"tools": {
"htmlcs": {
"AAA.1_3_1.H42": {
"quality": 1,
"what": "Heading coding is not used but the element may be intended as a heading",
"complaints": {
"countTotal": 2,
"texts": [
"Heading markup should be used if this content is intended as a heading."
]
}
}
},
"wave": {
"heading_possible": {
"quality": 1,
"what": "Possible heading",
"complaints": {
"countTotal": 17,
"texts": [
"Possible heading"
]
}
}
}
}
},
"scrollRisk": {
"score": 3,
"maxCount": 3,
"weight": 1,
"tools": {
"htmlcs": {
"AAA.1_4_10.C32,C31,C33,C38,SCR34,G206": {
"quality": 1,
"what": "Fixed-position element may force bidirectional scrolling",
"complaints": {
"countTotal": 3,
"texts": [
"This element has \"position: fixed\". This may require scrolling in two dimensions, which is considered a failure of this Success Criterion."
]
}
}
}
}
},
"contrastRisk": {
"score": 1,
"maxCount": 1,
"weight": 1,
"tools": {
"htmlcs": {
"AAA.1_4_3_F24.F24.FGColour": {
"quality": 1,
"what": "Inline foreground color may lack a complementary background color",
"complaints": {
"countTotal": 1,
"texts": [
"Check that this element has an inherited background colour or image to complement the corresponding inline foreground colour."
]
}
}
}
}
},
"linkWindowSurpriseRisk": {
"score": 13,
"maxCount": 13,
"weight": 1,
"tools": {
"htmlcs": {
"AAA.3_2_5.H83.3": {
"quality": 1,
"what": "Link text may fail to indicate that the link will open in a new window",
"complaints": {
"countTotal": 13,
"texts": [
"Check that this link's link text contains information indicating that the link will open in a new window."
]
}
}
}
}
},
"controlNoText": {
"score": 40,
"maxCount": 10,
"weight": 4,
"tools": {
"htmlcs": {
"AAA.1_3_1.F68": {
"quality": 1,
"what": "Form control has no label",
"complaints": {
"countTotal": 7,
"texts": [
"This form field should be labelled in some way. Use the label element (either with a \"for\" attribute or wrapped around the form field), or \"title\", \"aria-label\" or \"aria-labelledby\" attributes as appropriate."
]
}
}
},
"wave": {
"label_missing": {
"quality": 1,
"what": "form element has no label",
"complaints": {
"countTotal": 10,
"texts": [
"Missing form label"
]
}
}
}
}
},
"internalLinkBroken": {
"score": 4,
"maxCount": 1,
"weight": 4,
"tools": {
"htmlcs": {
"AAA.2_4_1.G1,G123,G124.NoSuchID": {
"quality": 1,
"what": "Internal link references a nonexistent destination",
"complaints": {
"countTotal": 1,
"texts": [
"This link points to a named anchor \"hypwppzmyxfaauwaoqlepkgzooebdhllfosv\" within the document, but no anchor exists with that name."
]
}
}
},
"wave": {
"link_internal_broken": {
"quality": 1,
"what": "Broken same-page link",
"complaints": {
"countTotal": 1,
"texts": [
"Broken same-page link"
]
}
}
}
}
},
"linkElementBad": {
"score": 24,
"maxCount": 6,
"weight": 4,
"tools": {
"htmlcs": {
"AAA.2_4_8.H59.1": {
"quality": 1,
"what": "link element is not in the document head",
"complaints": {
"countTotal": 6,
"texts": [
"Link elements can only be located in the head section of the document."
]
}
}
},
"nuVal": {
"A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet.": {
"quality": 1,
"what": "link element with a body ancestor has no itemprop or valid rel attribute",
"complaints": {
"countTotal": 3,
"texts": [
"A link element must not appear as a descendant of a body element unless the link element has an itemprop attribute or has a rel attribute whose value contains dns-prefetch, modulepreload, pingback, preconnect, prefetch, preload, prerender, or stylesheet."
]
}
}
}
}
},
"inputNoText": {
"score": 40,
"maxCount": 10,
"weight": 4,
"tools": {
"htmlcs": {
"AAA.4_1_2.H91.InputEmail.Name": {
"quality": 1,
"what": "Email input has no accessible name",
"complaints": {
"countTotal": 3,
"texts": [
"This emailinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute."
]
}
},
"AAA.4_1_2.H91.InputText.Name": {
"quality": 1,
"what": "Text input has no accessible name",
"complaints": {
"countTotal": 7,
"texts": [
"This textinput element does not have a name available to an accessibility API. Valid names are: label element, title attribute, aria-label attribute, aria-labelledby attribute."
]
}
}
}
}
},
"obsolete": {
"score": 12,
"maxCount": 4,
"weight": 3,
"tools": {
"ibm": {
"element_attribute_deprecated": {
"quality": 1,
"what": "Element or attribute is obsolete",
"complaints": {
"countTotal": 4,
"texts": [
"The HTML attribute(s) \"version\" is deprecated in HTML 5"
]
}
}
}
}
},
"roleBad": {
"score": 3,
"maxCount": 1,
"weight": 3,
"tools": {
"ibm": {
"aria_contentinfo_misuse": {
"quality": 1,
"what": "Element with a contentinfo role is present without an element with a main role",
"complaints": {
"countTotal": 1,
"texts": [
"The element with \"contentinfo\" role is present without an element with \"main\" role"
]
}
}
}
}
},
"parseError": {
"score": 6,
"maxCount": 2,
"weight": 3,
"tools": {
"nuVal": {
"^Bad start tag in .+$": {
"quality": 1,
"what": "Invalid start tag",
"complaints": {
"countTotal": 2,
"texts": [
"Bad start tag in img in noscript in head."
]
}
}
}
}
},
"slashParseRisk": {
"score": 46,
"maxCount": 46,
"weight": 1,
"tools": {
"nuVal": {
"Trailing slash on void elements has no effect and interacts badly with unquoted attribute values.": {
"quality": 1,
"what": "Void element has a useless trailing slash.",
"complaints": {
"countTotal": 46,
"texts": [
"Trailing slash on void elements has no effect and interacts badly with unquoted attribute values."
]
}
}
}
}
},
"elementClosure": {
"score": 18,
"maxCount": 6,
"weight": 3,
"tools": {
"nuVal": {
"^Stray end tag .+$": {
"quality": 1,
"what": "Invalid closing tag",
"complaints": {
"countTotal": 4,
"texts": [
"Stray end tag noscript.",
"Stray end tag head."
]
}
},
"^Start tag .+ seen but an element of the same type was already open.*$": {
"quality": 1,
"what": "Element is invalidly a descendant of another such element",
"complaints": {
"countTotal": 2,
"texts": [
"Start tag body seen but an element of the same type was already open."
]
}
}
}
}
},
"typeRedundant": {
"score": 5,
"maxCount": 5,
"weight": 1,
"tools": {
"nuVal": {
"The type attribute is unnecessary for JavaScript resources.": {
"quality": 1,
"what": "type attribute is unnecessary for a JavaScript resource",
"complaints": {
"countTotal": 5,
"texts": [
"The type attribute is unnecessary for JavaScript resources."
]
}
}
}
}
},
"fatalError": {
"score": 100,
"maxCount": 2,
"weight": 50,
"tools": {
"nuVal": {
"Cannot recover after last error. Any further errors will be ignored.": {
"quality": 1,
"what": "Testing was interrupted by a fatal error",
"complaints": {
"countTotal": 2,
"texts": [
"Cannot recover after last error. Any further errors will be ignored."
]
}
}
}
}
},
"metaBad": {
"score": 12,
"maxCount": 4,
"weight": 3,
"tools": {
"nuVal": {
"^Attribute .+ not allowed on element meta at this point.*$": {
"quality": 1,
"what": "Attribute is not allowed on a meta element here",
"complaints": {
"countTotal": 2,
"texts": [
"Attribute name not allowed on element meta at this point."
]
}
},
"^Element meta is missing one or more of the following attributes: .+$": {
"quality": 1,
"what": "meta element is missing a required attribute",
"complaints": {
"countTotal": 2,
"texts": [
"Element meta is missing one or more of the following attributes: itemprop, property."
]
}
}
}
}
},
"parentBad": {
"score": 8,
"maxCount": 2,
"weight": 4,
"tools": {
"nuVal": {
"^Element .+ not allowed as child of element .+ in this context.*$": {
"quality": 1,
"what": "Element has an invalid parent",
"complaints": {
"countTotal": 2,
"texts": [
"Element style not allowed as child of element body in this context. (Suppressing further errors from this subtree.)"
]
}
}
}
}
},
"cssInvalid": {
"score": 12,
"maxCount": 4,
"weight": 3,
"tools": {
"nuVal": {
"^CSS: .+: Character .+ is neither a decimal digit number.*$": {
"quality": 1,
"what": "Nonnumeric character in a numeric style property",
"complaints": {
"countTotal": 4,
"texts": [
"CSS: height: Character N is neither a decimal digit number, decimal point, nor \"e\" notation exponential mark."
]
}
}
}
}
},
"skipRepeatedContent": {
"score": 6,
"maxCount": 2,
"weight": 3,
"tools": {
"qualWeb": {
"QW-ACT-R64": {
"quality": 1,
"what": "Document has no heading for non-repeated content",
"complaints": {
"countTotal": 1,
"texts": [
"This rule checks that the non-repeated content contains a heading"
]
}
},
"QW-ACT-R75": {
"quality": 1,
"what": "Blocks of repeated content cannot be bypassed",
"complaints": {
"countTotal": 1,
"texts": [
"This rule checks that each page has a mechanism to bypass repeated blocks of content."
]
}
}
}
}
},
"errorReferenceBad": {
"score": 40,
"maxCount": 10,
"weight": 4,
"tools": {
"qualWeb": {
"QW-ACT-R41": {
"quality": 1,
"what": "Error message describes no invalid form field value",
"complaints": {
"countTotal": 10,
"texts": [
"This rule checks that text error messages provided when the user completes a form field with invalid values or using an invalid format, identify the cause of the error or how to fix the error."
]
}
}
}
}
},
"overflowHiddenRisk": {
"score": 34,
"maxCount": 34,
"weight": 1,
"tools": {
"qualWeb": {
"QW-ACT-R40": {
"quality": 1,
"what": "Zoomed text node may be clipped by a CSS overflow declaration",
"complaints": {
"countTotal": 34,
"texts": [
"This rule checks that text nodes are not unintentionally clipped by overflow, when a page is zoomed to 200% on 1280 by 1024 viewport."
]
}
}
}
}
},
"siteNavigation": {
"score": 19,
"maxCount": 19,
"weight": 1,
"tools": {
"qualWeb": {
"QW-WCAG-T15": {
"quality": 1,
"what": "link element and navigation tools not used",
"complaints": {
"countTotal": 19,
"texts": [
"The objective of this technique is to describe how the link element can provide metadata about the position of an HTML page within a set of Web pages or can assist in locating content with a set of Web pages."
]
}
}
}
}
},
"pseudoNavList": {
"score": 12,
"maxCount": 6,
"weight": 2,
"tools": {
"qualWeb": {
"QW-WCAG-T32": {
"quality": 1,
"what": "ol, ul or dl is not used for a list or group of links",
"complaints": {
"countTotal": 6,
"texts": [
"The objective of this technique is to create lists of related items using list elements appropriate for their purposes."
]
}
}
}
}
},
"submitButton": {
"score": 9,
"maxCount": 3,
"weight": 3,
"tools": {
"qualWeb": {
"QW-WCAG-T19": {
"quality": 1,
"what": "Submit button not provided",
"complaints": {
"countTotal": 3,
"texts": [
"The objective of this technique is to provide a mechanism that allows users to explicitly request changes of context. The intended use of a submit button is to generate an HTTP request that submits data entered in a form, so it is an appropriate control to use for causing a change of context."
]
}
}
}
}
},
"justificationRisk": {
"score": 2,
"maxCount": 2,
"weight": 1,
"tools": {
"qualWeb": {
"QW-WCAG-T29": {
"quality": 1,
"what": "Alignment either to the left or right is not specified in CSS",
"complaints": {
"countTotal": 2,
"texts": [
"This technique describes how to align blocks of text either left or right by setting the CSS text-align property."
]
}
}
}
}
},
"colorMissing": {
"score": 92,
"maxCount": 23,
"weight": 4,
"tools": {
"qualWeb": {
"QW-WCAG-T31": {
"quality": 1,
"what": "Foreground or background color is specified but not both",
"complaints": {
"countTotal": 23,
"texts": [
"Users with vision loss or cognitive, language and learning challenges often prefer specific foreground and background color combinations. In some cases, individuals with low vision will find it much easier to see a Web page that has white text on a black background, and they may have set their user agent to present this contrast. Many user agents make it possible for users to choose a preference about the foreground or background colors they would like to see without overriding all author-specified styles. This makes it possible for users to view pages where colors have not been specified by the author in their preferred color combination."
]
}
}
}
}
},
"horizontalScrolling": {
"score": 3,
"maxCount": 1,
"weight": 3,
"tools": {
"tenon": {
"28": {
"quality": 1,
"what": "Layout or sizing of the page causes horizontal scrolling",
"complaints": {
"countTotal": 1,
"texts": [
"The layout or sizing of this page causes horizontal scrolling."
]
}
}
}
}
},
"linkVague": {
"score": 3,
"maxCount": 1,
"weight": 3,
"tools": {
"tenon": {
"73": {
"quality": 1,
"what": "Link text is too generic to communicate the purpose or destination",
"complaints": {
"countTotal": 1,
"texts": [
"This link text is uninformative."
]
}
}
}
}
},
"linkTextsSame": {
"score": 10,
"maxCount": 5,
"weight": 2,
"tools": {
"tenon": {
"98": {
"quality": 1,
"what": "Links have the same text but different destinations",
"complaints": {
"countTotal": 5,
"texts": [
"These links have the same text but different destinations."
]
}
}
}
}
},
"fontSmall": {
"score": 6,
"maxCount": 2,
"weight": 3,
"tools": {
"tenon": {
"134": {
"quality": 1,
"what": "Text is very small",
"complaints": {
"countTotal": 2,
"texts": [
"Very small text found."
]
}
}
}
}
},
"leadingClipsText": {
"score": 8,
"maxCount": 2,
"weight": 4,
"tools": {
"tenon": {
"144": {
"quality": 1,
"what": "Line height is insufficent to properly display the computed font size",
"complaints": {
"countTotal": 2,
"texts": [
"This content's line height is insufficent to properly display the computed element font size."
]
}
}
}
}
},
"targetSize": {
"score": 54,
"maxCount": 18,
"weight": 3,
"tools": {
"tenon": {
"152": {
"quality": 1,
"what": "Actionable element is smaller than the minimum required size",
"complaints": {
"countTotal": 18,
"texts": [
"This actionable element is smaller than the minimum required size."
]
}
}
}
}
},
"allCaps": {
"score": 13,
"maxCount": 13,
"weight": 1,
"tools": {
"tenon": {
"153": {
"quality": 1,
"what": "Long string of text is in all caps",
"complaints": {
"countTotal": 13,
"texts": [
"This long string of text is in all caps."
]
}
}
}
}
},
"linkForcesNewWindow": {
"score": 39,
"maxCount": 13,
"weight": 3,
"tools": {
"tenon": {
"218": {
"quality": 1,
"what": "Link opens in a new window without user control",
"complaints": {
"countTotal": 13,
"texts": [
"This link opens in a new window without user control."
]
}
}
}
}
},
"textRotated": {
"score": 4,
"maxCount": 2,
"weight": 2,
"tools": {
"tenon": {
"271": {
"quality": 1,
"what": "Text is needlessly rotated 60+ degrees or more, hurting comprehension",
"complaints": {
"countTotal": 2,
"texts": [
"This text is rotated from the horizontal by 60 degrees or more."
]
}
}
}
}
},
"autocompleteNone": {
"score": 3,
"maxCount": 3,
"weight": 1,
"tools": {
"testaro": {
"autocomplete": {
"quality": 1,
"what": "Name or email input is missing its required autocomplete attribute",
"complaints": {
"countTotal": 3,
"texts": [
"Input is missing the required autocomplete attribute with value email"
]
}
}
}
}
},
"visibleBulk": {
"score": 1,
"maxCount": 1,
"weight": 1,
"tools": {
"testaro": {
"bulk": {
"quality": 1,
"what": "Page contains many visible elements",
"complaints": {
"countTotal": 1,
"texts": [
"Page contains a large number of visible elements"
]
}
}
}
}
},
"focusableOperable": {
"score": 6,
"maxCount": 2,
"weight": 3,
"tools": {
"testaro": {
"focOp": {
"quality": 1,
"what": "Tab-focusable elements that are inoperable or operable elements that are not focusable",
"complaints": {
"countTotal": 2,
"texts": [
null
]
}
}
}
}
},
"hoverSurprise": {
"score": 8,
"maxCount": 4,
"weight": 2,
"tools": {
"testaro": {
"hover": {
"quality": 1,
"what": "Hovering is impossible or mis-indicated or changes content",
"complaints": {
"countTotal": 4,
"texts": [
"Hovering over element has unexpected effects",
"Link or button makes the hovering mouse cursor nonstandard",
"List item changes when hovered over"
]
}
}
}
}
},
"labelClash": {
"score": 20,
"maxCount": 10,
"weight": 2,
"tools": {
"testaro": {
"labClash": {
"quality": 1,
"what": "Incompatible label types",
"complaints": {
"countTotal": 10,
"texts": [
"Element INPUT is unlabeled"
]
}
}
}
}
},
"linkIndication": {
"score": 88,
"maxCount": 44,
"weight": 2,
"tools": {
"testaro": {
"linkUl": {
"quality": 1,
"what": "Non-underlined adjacent links",
"complaints": {
"countTotal": 44,
"texts": [
"Link is inline but has no underline"
]
}
}
}
}
},
"inconsistentStyles": {
"score": 4,
"maxCount": 4,
"weight": 1,
"tools": {
"testaro": {
"styleDiff": {
"quality": 1,
"what": "Heading, link, and button style inconsistencies",
"complaints": {
"countTotal": 4,
"texts": [
"In-line links have 5 different styles"
]
}
}
}
}
},
"zIndexNotZero": {
"score": 12,
"maxCount": 12,
"weight": 1,
"tools": {
"testaro": {
"zIndex": {
"quality": 1,
"what": "Layering with nondefault z-index values",
"complaints": {
"countTotal": 12,
"texts": [
"NAV element has a non-default Z index",
"DIV element has a non-default Z index",
"UL element has a non-default Z index"
]
}
}
}
}
},
"linkPair": {
"score": 4,
"maxCount": 2,
"weight": 2,
"tools": {
"wave": {
"link_redundant": {
"quality": 1,
"what": "Adjacent links go to the same URL",
"complaints": {
"countTotal": 2,
"texts": [
"Redundant link"
]
}
}
}
}
},
"noScriptRisk": {
"score": 2,
"maxCount": 2,
"weight": 1,
"tools": {
"wave": {
"noscript": {
"quality": 1,
"what": "noscript element may fail to contain an accessible equivalent or alternative",
"complaints": {
"countTotal": 2,
"texts": [
"Noscript element"
]
}
}
}
}
}
}
}
}
}